KEGG   Xanthomonas oryzae pv. oryzicola: XOC_2787Help
Entry
XOC_2787          CDS       T01873                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Brite
Enzymes [BR:xor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     XOC_2787 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2855234..2855911)
Genome map
AA seq 225 aa AA seqDB search
MTPRLRLQPESVGIGMTSQRVRDRLVERLREAGIHDEATLNAVRTVPRHLFIDEALASRA
YEDTALPIGHGQTISQPWVVARMTEAVLQVTPTKVLEVGTGSGYQGAILAALGLEVYTVE
RIGDLLRQARKRFRHLGMNVRSKHDDGRIGWPEHGPYDAIVVTAAAPALVDALVDQLAVG
GRLVAPVGGASSQSLVQLTRGADGTIQQQVLAPVTFVPLLSGMLD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgaggctgcgcctgcaaccggagtcggtcggaatcggcatgacctcgcagcgc
gtgcgcgaccgcctggtcgaacggctgcgcgaggctggcatccacgacgaggcgacgctc
aacgcggtgcggaccgtgccgcggcacttgttcatcgatgaagcgctggcctcgcgcgcc
tacgaagacaccgcgctgccgatcggccacggccagaccatctcgcagccatgggtggtg
gcgcgcatgaccgaggcagtgctgcaagtgacgccgaccaaggtgctcgaagtgggcacc
ggctccggctaccagggcgcgattctggcggcgctggggctggaggtgtacaccgtcgag
cgcattggcgatctgttacggcaagcgcgcaagcgctttcggcatctgggcatgaacgtg
cgcagcaagcacgacgacggccgtatcggctggcccgagcacggcccctatgacgccatc
gtggtgaccgctgccgcaccggcgctggtcgatgcgctggtcgatcagctggcggtcggt
ggacgcctggtcgctccggtcggcggcgcttcctcgcaatcgctggtgcaactcacacgc
ggcgccgatggcaccatccaacaacaggtcctggcgccggtcacgttcgtcccgctgttg
tcgggcatgctggattga

DBGET integrated database retrieval system