KEGG   Xanthomonas oryzae pv. oryzicola: XOC_2832Help
Entry
XOC_2832          CDS       T01873                                 

Definition
cytochromeC2
Orthology
K08738  
cytochrome c
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    XOC_2832
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XOC_2832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2900661..2901029
Genome map
AA seq 122 aa AA seqDB search
MLCVPLAGLWLAGALPVPSAHAGDGAGTFLTECGECHSAKQGKNKKGPSLFGVAGRPAGT
VADFSGYSDALKNSKWTWTPAQLKTYLSHSSTKALPGTKMKYDGLDDPKELDALIAYLNT
LK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
gtgttgtgcgtcccgctggctggtctgtggctggcaggcgcactgcccgtgccctcggca
cacgctggcgacggcgccggcaccttcctcaccgaatgcggcgaatgccatagcgccaaa
cagggcaagaacaagaaaggcccgtccctgttcggcgtggccggccgccctgccggcacc
gtggccgatttcagcggttactccgacgcgctcaagaacagcaagtggacctggaccccg
gcccagctcaagacctacttgtcgcactcctcgaccaaggccctgccgggtaccaagatg
aagtacgacggcctggacgatccgaaggagctcgacgcgttgatcgcctacctcaacacc
ttgaagtag

DBGET integrated database retrieval system