KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_2940Help
Entry
XOC_2940          CDS       T01873                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XOC_2940 (tpiA)
   01230 Biosynthesis of amino acids
    XOC_2940 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOC_2940 (tpiA)
   00051 Fructose and mannose metabolism
    XOC_2940 (tpiA)
   00562 Inositol phosphate metabolism
    XOC_2940 (tpiA)
Enzymes [BR:xor01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     XOC_2940 (tpiA)
Exosome [BR:xor04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   XOC_2940 (tpiA)
  Exosomal proteins of bladder cancer cells
   XOC_2940 (tpiA)
  Exosomal proteins of melanoma cells
   XOC_2940 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3008659..3009417)
Genome map
AA seq 252 aa AA seqDB search
MMRRKIVAGNWKLHGSRAFATELVAKLAAHMPLEGVDVVILPPLPYLGELIEDFEAQHLS
FGAQDVSSNEKGAYTGEVSASMLVDVGAGYGLVGHSERRQYHQESSELVARKFAAAIHAG
LTPVLCVGESLEQREAGQTEAILRAQLEPVLALVGSAGFAGAVLAYEPIWAIGTGRTATP
EQAQAVHAFLRGEVAKADARIADSLPILYGGSVKPDNAGELFAQPDVDGGLVGGASLVAE
DFLAIARAAAAC
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgtcgaaagatcgttgccggaaattggaagctgcatggcagccgcgccttcgcc
accgaactggtggccaagctcgccgcgcacatgcccctggagggtgtcgacgtcgtcatc
ctgccgccactgccttacctcggcgagctgatcgaggatttcgaggcccaacacctgtcg
ttcggagcccaggacgtcagcagcaatgagaagggcgcctacactggcgaggtctcggcc
tcgatgttggtggatgtcggtgccggctacgggctggttggccactccgagcgccgtcag
taccatcaggagagtagcgagctggtggcgcgcaagttcgccgccgcgatccacgccggg
ctgactccggtgctgtgcgtgggcgaatcgctggaacagcgtgaagccggtcagactgag
gcgatcctacgtgcccagctcgaaccggtcctggcgctggtcggcagtgccggtttcgcg
ggcgccgtgctggcctatgaaccgatctgggccattggcaccggccgtaccgccacgccg
gagcaggcccaggccgtgcacgccttcctgcgtggcgaagtcgcgaaggccgatgctaga
atcgccgattcgttgcccatcctgtacgggggcagtgtcaagcccgataacgccggcgag
ctgttcgcacagcccgatgtcgatggcgggctggtcggaggcgcttcactggtcgccgaa
gatttcctggccatcgcacgcgcggcggccgcgtgctaa

DBGET integrated database retrieval system