KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_2952Help
Entry
XOC_2952          CDS       T01873                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
xor00260  Glycine, serine and threonine metabolism
xor00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xor01100  Metabolic pathways
xor01110  Biosynthesis of secondary metabolites
xor01130  Biosynthesis of antibiotics
xor01230  Biosynthesis of amino acids
Module
xor_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XOC_2952 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XOC_2952 (trpB)
Enzymes [BR:xor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XOC_2952 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEQ97051
UniProt: G7TL09
Position
complement(3020107..3021324)
Genome map
AA seq 405 aa AA seqDB search
MSAQPISDFYAYPDAAGHFGKFGGRFVAETLIGPLQELSAAYDQARQDPSFIAEYDKDLK
HYVGRPSPIYHAERLSREVGGAQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAE
TGAGQHGVASATVAARLGLECVVYMGATDIERQKINVYRMKLLGATVIPVTSGSATLKDA
LNEAMRDWVTNVRDTFYIIGTVAGPDPYPRMVRDFNAIVGREARAQMLEDYGRLPDAISA
CVGGGSNAIGLFHAFLNDPGVKIYGAEAAGDGIATGRHAASIAAGRPGVLHGNRTYLICD
DDGQITETHSISAGLDYPGVGPEHAFLSDSGRAVYQGITDDEAMAAFHLLAHTEGILAAL
ESSHAVAQSIKLARELPKDALVLCNLSGRGDKDVHTIAAREGLAL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcccagcccatcagtgacttttacgcctatccggatgctgccggccactttggc
aagtttggcggccggttcgtcgccgaaaccttgattggcccgctgcaggagctgtccgcc
gcctacgatcaagcgcggcaggatccgagcttcatcgccgaatacgacaaggatctcaag
cattacgtcggccgccccagcccgatctaccacgccgaacggctcagccgcgaagtgggt
ggggcgcagatcctgctcaagcgcgaagacctcaaccacaccggcgcgcacaagatcaac
aacaccatcggccaggccctgctggccagccgcatgggcaagacccgcatcattgccgag
accggtgccggccagcatggcgtggccagcgccaccgtcgctgcacgtctgggcctggaa
tgcgtggtctacatgggcgccaccgacatcgagcggcagaagatcaacgtctaccgcatg
aagctgctcggtgcgacggtgatcccggtgacctccggttcggccacgctcaaggacgcg
ctcaacgaagcgatgcgcgactgggtcactaacgtgcgcgacaccttctacatcatcggc
accgtggccggcccggacccgtatccgcgcatggtgcgcgacttcaatgcgattgtcggc
cgcgaggcgcgcgcgcagatgctggaagactacggccggctgccggatgcgatcagcgcc
tgcgtcggtggcggtagcaatgcgatcggcctgttccatgccttcctcaacgacccgggc
gtcaagatctatggcgccgaggcggccggcgacggcatcgctaccggccgccatgcggcg
tcgatcgcggcagggcgccccggtgtgttgcatggcaatcgcacctatttaatttgcgac
gacgatggccagatcaccgaaacccattcgatctctgccggcctggattaccccggcgtg
ggtccggagcatgcgtttctgtccgatagcggccgcgcggtgtatcagggcattaccgac
gacgaggcgatggccgcgttccatctgctggcgcataccgaaggcatcctggccgcactc
gaatccagccatgcggtggcgcagtcgatcaagctcgcgcgcgagctgccgaaagacgcg
ttggtgttgtgcaacctgtctgggcgtggcgacaaggatgtgcataccatcgcggcgcgc
gaggggctcgcgctgtag

DBGET integrated database retrieval system