KEGG   Xanthomonas oryzae pv. oryzicola: XOC_2952Help
Entry
XOC_2952          CDS       T01873                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XOC_2952 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XOC_2952 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XOC_2952 (trpB)
Enzymes [BR:xor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XOC_2952 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3020102..3021319)
Genome map
AA seq 405 aa AA seqDB search
MSAQPISDFYAYPDAAGHFGKFGGRFVAETLIGPLQELSAAYDQARQDPSFIAEYDKDLK
HYVGRPSPIYHAERLSREVGGAQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAE
TGAGQHGVASATVAARLGLECVVYMGATDIERQKINVYRMKLLGATVIPVTSGSATLKDA
LNEAMRDWVTNVRDTFYIIGTVAGPDPYPRMVRDFNAIVGREARAQMLEDYGRLPDAISA
CVGGGSNAIGLFHAFLNDPGVKIYGAEAAGDGIATGRHAASIAAGRPGVLHGNRTYLICD
DDGQITETHSISAGLDYPGVGPEHAFLSDSGRAVYQGITDDEAMAAFHLLAHTEGILAAL
ESSHAVAQSIKLARELPKDALVLCNLSGRGDKDVHTIAAREGLAL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcccagcccatcagtgacttttacgcctatccggatgctgccggccactttggc
aagtttggcggccggttcgtcgccgaaaccttgattggcccgctgcaggagctgtccgcc
gcctacgatcaagcgcggcaggatccgagcttcatcgccgaatacgacaaggatctcaag
cattacgtcggccgccccagcccgatctaccacgccgaacggctcagccgcgaagtgggt
ggggcgcagatcctgctcaagcgcgaagacctcaaccacaccggcgcgcacaagatcaac
aacaccatcggccaggccctgctggccagccgcatgggcaagacccgcatcattgccgag
accggtgccggccagcatggcgtggccagcgccaccgtcgctgcacgtctgggcctggaa
tgcgtggtctacatgggcgccaccgacatcgagcggcagaagatcaacgtctaccgcatg
aagctgctcggtgcgacggtgatcccggtgacctccggttcggccacgctcaaggacgcg
ctcaacgaagcgatgcgcgactgggtcactaacgtgcgcgacaccttctacatcatcggc
accgtggccggcccggacccgtatccgcgcatggtgcgcgacttcaatgcgattgtcggc
cgcgaggcgcgcgcgcagatgctggaagactacggccggctgccggatgcgatcagcgcc
tgcgtcggtggcggtagcaatgcgatcggcctgttccatgccttcctcaacgacccgggc
gtcaagatctatggcgccgaggcggccggcgacggcatcgctaccggccgccatgcggcg
tcgatcgcggcagggcgccccggtgtgttgcatggcaatcgcacctatttaatttgcgac
gacgatggccagatcaccgaaacccattcgatctctgccggcctggattaccccggcgtg
ggtccggagcatgcgtttctgtccgatagcggccgcgcggtgtatcagggcattaccgac
gacgaggcgatggccgcgttccatctgctggcgcataccgaaggcatcctggccgcactc
gaatccagccatgcggtggcgcagtcgatcaagctcgcgcgcgagctgccgaaagacgcg
ttggtgttgtgcaacctgtctgggcgtggcgacaaggatgtgcataccatcgcggcgcgc
gaggggctcgcgctgtag

DBGET integrated database retrieval system