KEGG   Xanthomonas oryzae pv. oryzicola: XOC_3017Help
Entry
XOC_3017          CDS       T01873                                 

Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    XOC_3017
   00565 Ether lipid metabolism
    XOC_3017
   00590 Arachidonic acid metabolism
    XOC_3017
   00591 Linoleic acid metabolism
    XOC_3017
   00592 alpha-Linolenic acid metabolism
    XOC_3017
Enzymes [BR:xor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     XOC_3017
    3.1.1.32  phospholipase A1
     XOC_3017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3075504..3076610
Genome map
AA seq 368 aa AA seqDB search
MLIALAAAPLAHAQEIAPQPASPQACTSVTSDAVRLACYDKALGYTPQLTAEADAAAQLA
KQKEAKHDDTRAISRVGDFFHADGQDQPKEEAVANAGRGSLLDRRWELAKDSKLGTFQLR
GYKPVYLLPAFWTSDTNRTPQSPNPANSVDTPQPLDSTELKFQLSFKTKVVEDLFGDNGD
IWMGYTQSSRWQAYNADASRPFRETNYEPEAMLVFRNNYSIFGWKGRMSGISLNHMSNGR
ADPLSRSWNRVILNFGLDRENWALTLRPWFRIKEDRADDNNPDIEDYMGRGDATLVYNKE
GHEFALIARHSLRGGDRSHGSVQLDYGFPITSLLRGHVQVFDGYGESMIDYNHKATYIGL
GVSLLEWF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgttgatcgccctggccgctgcgccattggcgcatgcgcaggaaatcgcaccgcagccg
gcctcgccgcaagcctgcacctcggtcacgtccgatgccgtgcgtctggcctgttacgac
aaggcgctgggctacaccccgcagctcaccgcggaggcggatgccgcagcgcaattggcc
aagcagaaggaagccaagcacgacgatacgcgcgcgatcagccgggtcggcgatttcttc
cacgccgacggacaggaccaacccaaagaagaagcggtagcaaacgcgggccgcggctcg
ttgctggaccgacgctgggaattggccaaggactccaagttaggcaccttccagctgcgt
ggctacaagccggtgtacctgttgccggcgttctggaccagcgacaccaaccgcaccccg
cagtcgcccaatccggccaactcggtcgacacgccgcagccactggacagcaccgagctg
aagttccagctcagcttcaagaccaaggtcgtcgaagacctgttcggcgacaacggcgat
atctggatgggctacacccagagctcgcgctggcaggcctacaacgccgatgcgtcgcgc
ccgtttcgcgagaccaattacgagcccgaggcgatgctggtgtttcgcaacaactacagc
atcttcggctggaagggacgcatgagcggcatcagcctcaatcacatgtccaatgggcgt
gcagacccgctgtcgcgctcctggaaccgggtcatcctgaacttcggcctggatcgcgag
aactgggccctgacactgcgcccgtggttccgcatcaaggaagaccgcgccgacgacaat
aatcccgatatcgaggattacatgggccgcggcgatgcgacgctggtgtacaacaaggag
ggtcacgaattcgcgctgatcgcacgccattcgctccgtggcggcgaccgctcgcacggc
tcggtgcagctggattacggcttcccgatcaccagcctgttgcgcggccacgtgcaagtg
ttcgacggttacggcgaaagcatgatcgactacaaccacaaggcgacttacatcggcctg
ggcgtgtcgctgctggagtggttctaa

DBGET integrated database retrieval system