KEGG   Xanthomonas oryzae pv. oryzicola: XOC_3022Help
Entry
XOC_3022          CDS       T01873                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    XOC_3022
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XOC_3022
Enzymes [BR:xor01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     XOC_3022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3082681..3083166)
Genome map
AA seq 161 aa AA seqDB search
MSDLSTFEFTDLEGRTQTMRDYAGKVLLVVNVASKCGFTPQYAGLQALWQRYRERGLVVI
GFPCDQFGHQEPGDAAQIRQFCLLDYAVDFPLAEKIEVNGSGAHPLWQWLKHEQRGVLGS
EAIKWNFTKFLIGRDGRVLARYAPTTKPEALAADIERALDA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatctctccacctttgaattcaccgaccttgagggtcgcacgcagacgatgcgc
gactacgccggcaaggtgctgctggtggtgaatgtggcatccaaatgcggctttacgccg
cagtacgccggcttgcaggccttatggcaacgctaccgcgagcgcgggctggtagtcatc
ggatttccgtgcgatcagtttgggcatcaagagccaggtgatgcggcgcagatccgccaa
ttttgcttgctcgactacgcagtggattttccgctggccgaaaaaatcgaggtcaacggc
agcggcgcgcatccgctgtggcaatggctcaagcacgaacaacgcggcgtgctcggctcc
gaggcgatcaagtggaatttcaccaaattcctgatcggccgcgacggccgcgtgctggca
cgttatgcgcccacgaccaagccggaagcattggccgcagatatcgagcgtgcattggac
gcatga

DBGET integrated database retrieval system