KEGG   Xanthomonas oryzae pv. oryzicola: XOC_3172Help
Entry
XOC_3172          CDS       T01873                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XOC_3172
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    XOC_3172
Enzymes [BR:xor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     XOC_3172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3231798..3232802)
Genome map
AA seq 334 aa AA seqDB search
MLLIGVAGTELSAQERDWLQHDAVAGVVLFKRNFGSRSQVVELSAAIRAAAPRPVLICVD
QEGGRVQRFREGFSALAPLQSFGAQYAQAPEAALAAARAHAQLMASEVRASGVDLSFAPV
VDLGRGNRAIGDRAFSDDPQIVATFTRAYVQALHGAGMAATLKHFPGHGTVLEDTHVDHA
SDPRPLEALQAEDLVPFVAGIEAGADAVMMAHVVYPQVAPEPAGYSQRWIEQILRGQMGF
RGVVFSDDIGMAASFSAGGVAGRVHAHLDAGCDVVLVCHPELVAESLQAVQGRRLNTAAL
IGLIGRGALGWDGLLAGTDVSFTTPHSAHFGTTA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcttctgatcggcgttgccggtaccgaactcagcgcacaggaacgcgactggctgcag
cacgatgcggttgccggcgtggtgctgttcaagcgtaacttcggctcgcgcagccaggtg
gtcgagctgtcggcggcgatccgcgcggcagcgccgcgcccggtgctgatctgcgtggac
caggaaggcggacgcgtgcagcggtttcgcgaaggattcagcgcgctggcaccgttgcaa
agtttcggggcgcagtacgcgcaggcccctgaggctgcattggctgccgcacgcgcacat
gcgcagctgatggccagcgaggtccgcgccagtggtgtggacctgagcttcgcgccggtg
gtggatctaggccgcggcaatcgcgccatcggcgatcgcgccttcagcgacgacccgcag
atcgtggccaccttcacccgcgcttatgtgcaggcgctgcacggcgccggcatggccgcc
acgctcaaacattttcccggccacggcactgtgcttgaagacacccatgtcgaccacgcc
agcgacccgcggccgctggaggcgttgcaggccgaagatctggtgccgttcgtggccggc
atcgaggccggcgccgacgcggtgatgatggcgcacgtggtttacccccaggtggccccg
gaaccggctgggtattcgcagcgctggatcgaacagatcctgcgcggccagatgggcttc
cgcggcgtggtcttttccgacgatatcggcatggccgcctcgttcagtgccggcggcgtg
gcaggccgggtgcatgcgcatctggatgccggctgcgatgtggtgttggtctgccacccg
gaactggtcgccgaatcgctgcaggccgtgcagggccgtcgcctcaataccgccgcattg
atcggcctgatcggccgcggcgcattgggctgggatggcctgctcgccggcaccgacgtc
tcattcaccactcctcattctgcccatttcggaacaactgcctga

DBGET integrated database retrieval system