KEGG   Xanthomonas oryzae pv. oryzicola: XOC_3189Help
Entry
XOC_3189          CDS       T01873                                 

Definition
fatty oxidation complex alpha subunit
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XOC_3189
   01212 Fatty acid metabolism
    XOC_3189
  Carbohydrate metabolism
   00640 Propanoate metabolism
    XOC_3189
   00650 Butanoate metabolism
    XOC_3189
  Lipid metabolism
   00071 Fatty acid degradation
    XOC_3189
   01040 Biosynthesis of unsaturated fatty acids
    XOC_3189
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XOC_3189
   00310 Lysine degradation
    XOC_3189
   00380 Tryptophan metabolism
    XOC_3189
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XOC_3189
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XOC_3189
   00281 Geraniol degradation
    XOC_3189
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    XOC_3189
Enzymes [BR:xor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     XOC_3189
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     XOC_3189
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     XOC_3189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3248940..3251021
Genome map
AA seq 693 aa AA seqDB search
MLPGFDGLRFSHWQAELREDGVVVLSLDRQDAPVNAFSQEVLLELGALVERLALEPPKGV
VLRSGKANGFIAGADLKEFQQFDHKGTVNDAIHRGQQVFQKLAELPCPTVAAIHGFCMGG
GTEIALACRYRVASDDGSTRIGLPEIKLGIFPGWGGSARLPRLIGAPAAMDLMLSGRTVS
AKAARAMGLVDKVAAPAVLVDAAAALALAGTTRPFQQRATAWATNTLLARKILAPQMRKQ
VARKARKEHYPAPYALITVWERAGGSGIQARLAAERKAVVKLASTPTARNLIRIFFLTER
LKALGGKDAAGAAAAPIRHVHVIGVGVMGGDIAAWAAYKGFDVTLQDREQRFIETALTRG
GELFAKRVKDDAKRPAVAARLRGDLAGAGVRQADLVIEAIIENPQAKRDLYQSIEPQLKP
DALLTTNTSSIPLTELRGHIQRPAQFAGLHYFNPVAMMPLVEIVQHDGLDPANVARLAAF
CKALDKFPVPVAGTPGFLVNRVLFPYLLEAATAYADGIPGPVLDKTAVKFGMPMGPIELI
DTVGLDVAAGVGAELAPFLHLPIPAALITVEAGKRGKKDGQGLYTWENGRAVKPEVASGY
TAPADLEDRLILPLLNEAVACLHDGVVADADLLDAGVIFGTGFAPFRGGPIQHIRSVGAD
ALLERLQALHARYGERFAPRPGWDSPVLREAVV
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaggtttcgacgggctccgattcagccattggcaggccgagctgcgcgaggac
ggcgtggttgtgctcagcctcgatcgccaggacgcaccggtcaacgcattttcccaggag
gtgctgctggagttgggcgcactggtcgagcgcctggcactggagccgcccaagggcgtg
gtgctgcgctcgggcaaagccaacggctttatcgccggtgccgatctgaaagaatttcag
caattcgaccacaagggcacggtcaacgatgcgattcatcgcgggcagcaggtctttcag
aagctggcagaactgccctgcccgaccgttgcggcgattcatggcttctgcatgggcggc
ggcaccgaaatcgcgctggcatgccgctaccgcgtggcctccgacgatggcagtacgcgc
atcgggttgccggaaatcaagctcggcatcttccccggctggggcggcagcgcccgcttg
ccgcgcctgatcggtgcgccggcggcgatggacctgatgctcagcggccgcaccgtgtcg
gccaaggctgcgcgcgcaatgggtctggtcgacaaggtcgccgcacctgcggtgctggtc
gatgcggctgcggcactggcgctcgcgggtacgacgcgtccgttccagcagcgcgccact
gcgtgggccaccaacactttgctggcgcgcaaaatactggcgccgcagatgcgcaaacaa
gtggcccgcaaggcgcgcaaggagcattaccctgcgccatacgcgttgatcacggtgtgg
gagcgggctggcggcagcggcattcaggcccgcctggcggccgagcgcaaggcagtggtc
aagctcgccagcacgccgaccgcacgcaacctgatccgcatcttcttcctgaccgagcgc
ttgaaggcgctgggcggcaaggatgcagccggcgcagcagcggcgccgatccgccacgtg
cacgtcatcggcgttggcgtgatgggcggcgacatcgcggcgtgggcggcctacaagggc
ttcgacgtcacgttgcaggaccgcgagcagcgttttatcgaaacggcgctgacgcgcggc
ggcgaactgttcgccaagcgcgtcaaagacgacgccaagcggccggccgtggccgcgcgt
ctgcgcggtgatctggccggtgcgggtgtgaggcaggccgatctggtgatcgaggcgatc
atcgaaaacccgcaggccaagcgcgatctgtatcaatcgatcgagccgcagctcaagccg
gatgcattgctgaccaccaatacatcgtcgattccgctgaccgaattgcgtggccacatc
cagcgcccggcgcagttcgccggcctgcactatttcaacccggtggcgatgatgccgctg
gtggaaatcgtgcagcacgatggtctggatcccgccaacgtggcgcgcctggctgcattc
tgcaaggcactggacaagttcccggtgccggtggccggcacgccggggttcctggtcaac
cgggtgctgttcccgtacctgctcgaagcggccaccgcgtatgcggacggcatacccggc
ccggtgctggacaagacggcggtgaaattcggcatgccgatggggccgatcgagttgatc
gacaccgtgggtctggacgtcgccgccggcgtgggcgcggagttggcgccgttcctgcac
ctgccgattccggcagcgctgatcacggtggaagccggcaagcgcggcaagaaggatggc
cagggcttgtacacgtgggagaatgggcgtgcggtcaaaccggaggttgccagtggctac
accgcaccggcagatctggaagaccggctgattctgccgctgctcaacgaagcggtggcg
tgtctgcacgacggcgtggtggctgacgcagacctgctcgatgccggcgtcatcttcggc
accggctttgcgcccttccgtggtggcccgatccagcacatccgcagcgtcggcgcagat
gcgctgctggaacgtttgcaggcgctgcacgcacgttatggcgaacgtttcgcaccgcgc
ccgggttgggactcgccggtgttgcgggaggcggtggtgtaa

DBGET integrated database retrieval system