KEGG   Xanthomonas oryzae pv. oryzicola: XOC_3259Help
Entry
XOC_3259          CDS       T01873                                 

Definition
beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XOC_3259
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    XOC_3259
Enzymes [BR:xor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     XOC_3259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3330564..3333014
Genome map
AA seq 816 aa AA seqDB search
MMSNSAPTARPTAGAPLSSRLLALVFAATSLAGCGQRVPGTPPAAATAGAPAAAAANTAR
TPLPLIPAAVEVKRGNGSFVVGTGTVISIVPGDADARRSAEHLADLLLRTRGLRLEVRAE
TSASPGSIRLERSAQAPVAHKEGYSLEVDAKGVRIAARDGAGLLYGAVSAWQLMTPDTHK
GEIQLPSVAIRDWPRFSWRGQHLDVARHFHDVDTVKHVLDTMALHKLNVLHWHLTDDQGW
RIEIKRYPKLTEVGAWRTPPGAGMDGIPQRDGGFYTQEQISEIVAYAARLHITVLPEIDM
PGHAQAAVAAYPEEVGVPGVRTQVGVDWGVNPYLFNTSERSLTFITNVLDEVLTLFPSTY
IHIGGDEAVKDQWEASPAVRAQMRKLGVKDAHAMQGWFNEQLAAYLIQHGRRMIGWDEIL
EGGVPASASVMSWRGVEGAVTAAKQGHDVVLAPGDWLYLDNLQTTRNDEPNGRLTVLPLS
KVYAFDPVPAGLSAEQARHVLGAQGALWSEYISSRWHVDHALFPRLSAVAEVTWSPKAAR
NWNSFLARMPAQLQRYKALGIDYSDGAFAADIALENGPNPVLTGGPAKVALSTQTGAGTL
HYTIDGSHPTPASPRYNAPFTIQLPTTVKATAFDANGTPLAATRSRTFDRAGLLRVDTQG
LQHCVETGALGLRLPLLPEMTAADTPVYNVDLFHACRMYPQARLDGIGAIRIDAARLPNN
FGLAHEQSKVVQYPANTRGGELEVRQGCDGELIASVQLPRSDTLGEQFTLETALPARTGI
HDLCLRFTAPIRGPLYAIGAVQLIETTAQAPPAATR
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgaactccgcacccaccgcacgcccgacagcaggcgcgccgttgtcctcgcgc
ctgcttgcgctcgtgttcgcagcaacgtcgctggccggttgcggtcaacgtgtacctggc
actccaccagccgccgccacggcgggcgcacctgccgctgcagcggcaaacaccgcgcgt
acaccgttgccactgattcctgcagccgtcgaggtcaaacgcggtaacggcagcttcgtc
gtgggcaccggtacggtgatctcgatcgtgcctggcgatgccgatgcacgtcgcagtgcc
gaacatctggccgatctgctgctgcgcacacgcgggctgcgattggaagtgcgcgccgaa
accagcgcatcgccgggcagcatccgcctggagcgcagcgcgcaggcgccggtagcgcac
aaggaaggctacagcctggaggtggatgccaagggcgtgcgcatcgccgcgcgcgatgga
gccggcttgttgtatggcgcagtcagcgcctggcaattgatgacaccggatacgcacaag
ggcgagatccagctgccgtcggtggcgatccgcgactggccgcgtttcagctggcgcggc
cagcatctggatgtggcccggcattttcatgatgtggacacggtcaagcatgtgctcgat
acgatggccctgcacaagctcaacgtgctgcattggcatctcaccgatgaccagggctgg
cgcatcgagatcaagcgctatcccaagctcacggaggtcggcgcctggcgcacgccgccg
ggcgcgggaatggacggcataccgcagcgtgatggcggcttctacacgcaggaacagatc
agcgagatcgtcgcttacgccgcgcgcctgcacatcaccgtgctgccggagatcgacatg
cccgggcatgcacaggcggccgttgccgcctatcccgaagaggtgggcgtccccggtgtg
cgcacccaggtgggcgtggactggggcgtcaacccgtacctgttcaacaccagcgaacgc
agcctgaccttcatcaccaatgtgctggatgaagtgctgaccttgttcccctcgacctac
atccacatcggtggcgatgaggcggtcaaggatcaatgggaagcctcgccggcggtgcgc
gcgcagatgcgcaagctcggagtcaaggacgcgcatgcgatgcagggctggttcaacgaa
cagctggcggcctacctcatccagcacggccggcgcatgatcggctgggatgaaatcctg
gaaggcggcgtgccggcgagtgcgtcggtgatgtcgtggcgcggcgtcgaaggtgcggtc
actgcggccaagcaaggccacgacgtggtgcttgcgccgggcgactggctgtatctggac
aatctgcaaaccacgcgcaacgacgaaccgaacggtcgcctgaccgtgttgccgctgtcg
aaggtctatgcattcgacccggtgccggccgggctcagcgccgaacaggccaggcatgtg
ctgggcgcacaaggcgcgttgtggtccgaatacatttcctcgcgctggcatgtagatcac
gcgctgtttccgcggctgtctgcggtggcagaagtgacctggtcgcccaaggcggcacgc
aactggaacagcttcctggcgcgtatgccggcacagctgcagcgctacaaggcgctgggc
atcgactacagcgacggcgcattcgctgccgatatcgcgctggaaaacggacccaaccca
gtgctcaccggcggcccggccaaggtggcgctgagcacgcagactggggcgggcacgctg
cactacaccatcgatggcagccatcccacaccggcatcgccacgctacaacgcaccgttt
acgattcaattgccgaccacggtcaaggccacggcgttcgatgccaacggcacgccgctg
gcggcaacgcgcagccgcacctttgatcgcgccggcttgttgcgcgtagacacgcaaggc
ttgcaacactgcgtcgaaaccggcgcactcggcttgcgtctgccgctattgccggagatg
accgccgccgacacgccggtgtacaacgtcgatctgttccatgcctgccgcatgtatccg
caggcgcggctggacggcatcggcgccatccgcatcgacgccgcacgcctgcccaataac
ttcggcctggcgcatgagcaatccaaggtcgtgcagtacccggccaacacacgcggcggt
gagctggaagtgcgtcagggctgcgatggcgaattgatcgccagcgtgcagctgccgcgc
agcgacaccctgggtgagcaattcacgctggaaaccgcactgcctgcacgcaccggcatc
cacgatctctgcctgcgctttaccgcgccgattcgtggcccgttgtatgccatcggcgcc
gttcaactgattgaaaccaccgcgcaggcgccccccgccgccacgcgctga

DBGET integrated database retrieval system