KEGG   Xanthomonas oryzae pv. oryzicola: XOC_3273Help
Entry
XOC_3273          CDS       T01873                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xor00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3350580..3352421
Genome map
AA seq 613 aa AA seqDB search
MLRTTLAPLVLALTFALPVTAAAADTERWPDFGTQGTQFVRDGKPYQLLSGAIHFQRIPR
AYWKDRLQKARALGLNTVETYVFWNLVEPQQGQFDFSGNNDVAAFVQEAAAQGLNVILRP
GPYACAEWEAGGYPAWLFGQGNIRVRSRDPRFLAASQAYLDAVAKQVQPLLNHNGGPIIA
VQVENEYGSYADDHAYMADNRAMYVKAGFDKALLFTSDGAEMLANGTLPDTLAVVNFAPG
EAKSAFDKLIAFRPDQPRMVGEYWAGWFDHWGKPHAATDATQQAEEFEWILRQGHSANLY
MFIGGTSFGFMNGANFQNNPSDHYAPQTTSYDYDAIVDEAGRPTAKFALMRDAIARVTGV
QPPALPAPIATTTLPDTPLRESASLWDNLPAPIAIDTPQPMEHFGQDYGYILYRTTVTGP
RKGPLYLGDVRDVAHVYLDQTPVGSVERRLQQVSTTVDIPAGHHTLDVLVENSGRINYGT
RMADGRAGLVDPVLLGNQQLTGWQAFPLPMRTPDSIRGWTRKAVQGPAFHRGTVRIGTPA
DTYLDMRAFGKGFAWANGVNLGRHWNIGPQTALYFPAPFQRRGDNTVVVFDLDDVATPSV
RGLKQQVWLKPKE
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtaccacccttgcaccgctcgttctggcgctcaccttcgcgctgcctgtcact
gctgcagccgcagacaccgaacgctggccggacttcggcacgcaaggcacacagttcgtg
cgcgacggcaagccgtatcaactgctttccggcgccatccatttccagcgcattccgcgc
gcctactggaaagaccgcctgcaaaaagcgcgtgcgctgggcttgaacacggtggaaacc
tacgtgttctggaatctggtggaaccgcagcaaggccagttcgatttttccggcaacaac
gacgtggccgcgttcgtgcaagaagctgccgcgcaggggttgaatgtcatcctgcggccc
ggcccttacgcctgcgcagagtgggaagccggcgggtatccggcctggttgttcggccag
ggcaacattcgcgtgcgcagccgcgacccacgctttcttgctgccagccaggcctatctg
gatgcggtggccaaacaggtgcagccgctgctcaaccacaacggcgggccgatcatcgcc
gtgcaggtcgagaacgaatacggctcttacgccgacgaccacgcctacatggccgacaac
cgcgccatgtacgtcaaggccggcttcgacaaggccttgctgttcacctccgatggcgcc
gagatgctcgccaacggcaccttgcccgacaccttggcggtggtgaacttcgcacccggc
gaagccaagagcgcattcgacaagctgatcgcgttccgccccgatcaaccgcgcatggtc
ggcgaatactgggcgggctggttcgaccattggggcaagccgcacgccgccaccgatgcc
acacaacaggccgaggagttcgagtggatcctgcgccagggccactccgccaatctctac
atgttcatcggcggcaccagttttggcttcatgaacggcgccaatttccagaacaatccc
agcgatcattacgcaccgcagaccaccagctacgactacgacgccattgtcgacgaagcc
gggcgccccacagccaagttcgcgttgatgcgcgatgccatcgcccgcgtcaccggtgtg
cagccgcctgcattgccggcaccgatcgcgaccaccacgctgccagacacgccgttgcgc
gaatcggcctcgctgtgggacaacctgcccgcaccgatcgccatcgacaccccgcagccg
atggaacacttcggccaggattacggctacatcctttatcgcaccaccgtcaccggcccg
cgcaagggcccgctgtatctgggcgacgtgcgcgatgtggcgcacgtgtatctggatcag
acgccggtcggcagcgtcgaacgccggctgcagcaggtctccaccactgtggatattccg
gccggccaccacacgctggatgtgctggtggaaaacagcggccgcatcaattacggcacg
cgcatggccgacggccgcgccggcctggtcgacccggtgctgctgggcaaccagcaactc
accggctggcaggccttcccgctgccgatgcgcacacccgacagcatccgcggctggacc
cgcaaggcagtgcaaggcccagcgttccaccgcggcaccgtgcgcatcggcacacccgcc
gacacctacctggacatgcgcgccttcggcaagggcttcgcctgggccaacggcgtcaac
ctcggccgccactggaacatcggcccgcagaccgcgctgtatttccccgcgccgttccag
cgcaggggtgacaacacggtggtggtcttcgacctagacgatgtcgccacacccagcgtg
cgcggcctgaagcagcaggtgtggctcaagccgaaagagtga

DBGET integrated database retrieval system