KEGG   Xanthomonas oryzae pv. oryzicola: XOC_3273Help
Entry
XOC_3273          CDS       T01873                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    XOC_3273
Enzymes [BR:xor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     XOC_3273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3350580..3352421
Genome map
AA seq 613 aa AA seqDB search
MLRTTLAPLVLALTFALPVTAAAADTERWPDFGTQGTQFVRDGKPYQLLSGAIHFQRIPR
AYWKDRLQKARALGLNTVETYVFWNLVEPQQGQFDFSGNNDVAAFVQEAAAQGLNVILRP
GPYACAEWEAGGYPAWLFGQGNIRVRSRDPRFLAASQAYLDAVAKQVQPLLNHNGGPIIA
VQVENEYGSYADDHAYMADNRAMYVKAGFDKALLFTSDGAEMLANGTLPDTLAVVNFAPG
EAKSAFDKLIAFRPDQPRMVGEYWAGWFDHWGKPHAATDATQQAEEFEWILRQGHSANLY
MFIGGTSFGFMNGANFQNNPSDHYAPQTTSYDYDAIVDEAGRPTAKFALMRDAIARVTGV
QPPALPAPIATTTLPDTPLRESASLWDNLPAPIAIDTPQPMEHFGQDYGYILYRTTVTGP
RKGPLYLGDVRDVAHVYLDQTPVGSVERRLQQVSTTVDIPAGHHTLDVLVENSGRINYGT
RMADGRAGLVDPVLLGNQQLTGWQAFPLPMRTPDSIRGWTRKAVQGPAFHRGTVRIGTPA
DTYLDMRAFGKGFAWANGVNLGRHWNIGPQTALYFPAPFQRRGDNTVVVFDLDDVATPSV
RGLKQQVWLKPKE
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtaccacccttgcaccgctcgttctggcgctcaccttcgcgctgcctgtcact
gctgcagccgcagacaccgaacgctggccggacttcggcacgcaaggcacacagttcgtg
cgcgacggcaagccgtatcaactgctttccggcgccatccatttccagcgcattccgcgc
gcctactggaaagaccgcctgcaaaaagcgcgtgcgctgggcttgaacacggtggaaacc
tacgtgttctggaatctggtggaaccgcagcaaggccagttcgatttttccggcaacaac
gacgtggccgcgttcgtgcaagaagctgccgcgcaggggttgaatgtcatcctgcggccc
ggcccttacgcctgcgcagagtgggaagccggcgggtatccggcctggttgttcggccag
ggcaacattcgcgtgcgcagccgcgacccacgctttcttgctgccagccaggcctatctg
gatgcggtggccaaacaggtgcagccgctgctcaaccacaacggcgggccgatcatcgcc
gtgcaggtcgagaacgaatacggctcttacgccgacgaccacgcctacatggccgacaac
cgcgccatgtacgtcaaggccggcttcgacaaggccttgctgttcacctccgatggcgcc
gagatgctcgccaacggcaccttgcccgacaccttggcggtggtgaacttcgcacccggc
gaagccaagagcgcattcgacaagctgatcgcgttccgccccgatcaaccgcgcatggtc
ggcgaatactgggcgggctggttcgaccattggggcaagccgcacgccgccaccgatgcc
acacaacaggccgaggagttcgagtggatcctgcgccagggccactccgccaatctctac
atgttcatcggcggcaccagttttggcttcatgaacggcgccaatttccagaacaatccc
agcgatcattacgcaccgcagaccaccagctacgactacgacgccattgtcgacgaagcc
gggcgccccacagccaagttcgcgttgatgcgcgatgccatcgcccgcgtcaccggtgtg
cagccgcctgcattgccggcaccgatcgcgaccaccacgctgccagacacgccgttgcgc
gaatcggcctcgctgtgggacaacctgcccgcaccgatcgccatcgacaccccgcagccg
atggaacacttcggccaggattacggctacatcctttatcgcaccaccgtcaccggcccg
cgcaagggcccgctgtatctgggcgacgtgcgcgatgtggcgcacgtgtatctggatcag
acgccggtcggcagcgtcgaacgccggctgcagcaggtctccaccactgtggatattccg
gccggccaccacacgctggatgtgctggtggaaaacagcggccgcatcaattacggcacg
cgcatggccgacggccgcgccggcctggtcgacccggtgctgctgggcaaccagcaactc
accggctggcaggccttcccgctgccgatgcgcacacccgacagcatccgcggctggacc
cgcaaggcagtgcaaggcccagcgttccaccgcggcaccgtgcgcatcggcacacccgcc
gacacctacctggacatgcgcgccttcggcaagggcttcgcctgggccaacggcgtcaac
ctcggccgccactggaacatcggcccgcagaccgcgctgtatttccccgcgccgttccag
cgcaggggtgacaacacggtggtggtcttcgacctagacgatgtcgccacacccagcgtg
cgcggcctgaagcagcaggtgtggctcaagccgaaagagtga

DBGET integrated database retrieval system