KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_3425Help
Entry
XOC_3425          CDS       T01873                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
xor00010  Glycolysis / Gluconeogenesis
xor00052  Galactose metabolism
xor01100  Metabolic pathways
xor01110  Biosynthesis of secondary metabolites
xor01120  Microbial metabolism in diverse environments
xor01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOC_3425
   00052 Galactose metabolism
    XOC_3425
Enzymes [BR:xor01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     XOC_3425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEQ97519
UniProt: G7TDJ1
Position
complement(3519452..3520501)
Genome map
AA seq 349 aa AA seqDB search
MQRVFGQLPDGVEIHALTLRSEAGLEAEVLTYGGILHTLQLTTARGVLPLVLNLPDLPAY
AADGDSLNILVGRFGNRIAGARYTLDGVTHVLAANEGRNQLHGGLRGFGRRVWSVLEQAP
DHVLLGYDSPDGEEGYPGNLQVRARLQLHGLSLELDFEAHCDAATALNLTHHPYFNLSGD
PHLRAAAQVLRVPADRYLLVDAESIPTGEIASVAGTPFDFRQPAALADNTDPAHPQVVLG
KGYDQCLVLAADADCVAELYSPHSGVALRIRSDAPAVQLYEGQHLDAHHPGLGRGVCLEP
QDYPDAPNHANFPSTILRPGETYRRRISYHFASAGQDQPWDMVCAALER
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgagtgttcgggcagttgccagacggtgtcgagattcatgcgctcacgctacgc
agcgaggccggtctcgaggcggaggtgctcacctatggcggcatcctgcatacactgcag
ttgaccaccgcacggggtgtgctgcccctggtgctgaacttgccggatctgcccgcctac
gccgctgacggcgacagtctcaacatcctggtgggccgcttcggcaaccgcatcgccggt
gcgcgctacacgctggacggcgttacccacgtgctggcggccaatgaagggcgcaaccag
ttgcatggcggtctgcgcggttttgggcgacgcgtgtggagcgtgctggagcaggcgccg
gatcacgtactgctgggctacgactcgcccgatggcgaagaaggttaccccggcaatctg
caagtgcgtgcgcgcctgcagcttcacgggttgagcctggagctggatttcgaagcgcac
tgcgatgccgctacggcgttgaaccttacccatcatccatatttcaatttgtccggcgac
ccgcacctgcgtgccgcagcgcaagtgctgcgcgtgccggccgatcgctacctgctggtg
gatgccgaatcgatcccgaccggcgagatcgcgtcggtggccggcaccccattcgatttc
cgccagcctgccgcgctcgccgataacaccgacccggcccatccgcaggtggttctcggt
aagggctacgatcagtgcctggtgctggccgccgacgcggactgcgtagccgagttgtat
tcgccgcacagtggcgtggcgctacgcatccgcagcgatgcccccgcggtgcagttgtac
gaaggccaacatctggacgcacatcatccgggactggggcgcggcgtatgcctggagccg
caggactacccggacgcgcccaatcacgccaacttcccttcgacgatcttacggcctggg
gaaacctaccgtcgccgcatcagctaccacttcgccagtgcggggcaggaccagccctgg
gacatggtgtgcgccgcactggagcggtga

DBGET integrated database retrieval system