KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_3504Help
Entry
XOC_3504          CDS       T01873                                 

Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
xor00020  Citrate cycle (TCA cycle)
xor00640  Propanoate metabolism
xor00660  C5-Branched dibasic acid metabolism
xor01100  Metabolic pathways
xor01110  Biosynthesis of secondary metabolites
xor01120  Microbial metabolism in diverse environments
xor01130  Biosynthesis of antibiotics
xor01200  Carbon metabolism
Module
xor_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xor_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XOC_3504
   00640 Propanoate metabolism
    XOC_3504
   00660 C5-Branched dibasic acid metabolism
    XOC_3504
Enzymes [BR:xor01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     XOC_3504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Citrate_bind GARS_A
Motif
Other DBs
NCBI-ProteinID: AEQ97598
UniProt: G7TE81
Position
complement(3607090..3608259)
Genome map
AA seq 389 aa AA seqDB search
MNFHEYQSKQLLAEYGIPVPAGKVAATPDEAVDVATSLGKGPWMVKAQIHAGGRGKAGGV
KFCKTTDDVKAAAAKMLGTKMSTYQTAGVELPINLVLVTTAGEIVKELYLSILVDRGTKT
ITYIASSEGGVEIEQVAAETPELIHALNVDFVEGVQGYHGRDFGFKLGLNAKQAGQFASI
MVNLYKLFNEKDLALVEINPLAILDDGNLYALDGKFDSDDNAAFRQKQLIAMRDKTQEDE
TEVTASELDINYVTMDGNIGCMVNGAGLAMATMDVIKLNGGEPANFLDVGGGANKQRVIE
AFKLILSSDKVEGIFVNIFGGIVRCDMIAEGIIAAVKEVGVKVPVVVRLEGTNVEEGKQL
LRDSGMAIIPADNINDGAKKVVEAVKNAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccacgaataccagtcaaaacagctgcttgccgagtacggcatccccgtcccg
gccggcaaggtcgcggcgaccccggacgaagcggttgacgtcgccacttccctgggcaag
ggtccttggatggtgaaagcgcagatccacgcgggtggccgcggtaaggctggcggcgtc
aagttctgcaagaccaccgacgacgtgaaggccgcagcagccaagatgctcggcaccaag
atgtccacctaccagaccgccggcgtcgagctgccgatcaatctggtgctggtgaccacg
gccggtgagatcgtcaaggagctgtacctgtcgatcctggtcgaccgcggcaccaagacc
atcacctatatcgcctcaagcgaaggcggcgtggagatcgagcaggtcgcggccgaaacg
ccggagctgatccacgcgctcaacgtcgatttcgtcgaaggcgtgcagggttatcacggt
cgcgatttcggcttcaagctgggcctcaacgccaagcaggccggccagttcgccagcatc
atggtgaacttgtacaagctgttcaacgaaaaggacctggcgctggttgaaatcaacccg
ctggcgatcctggacgacggcaacctgtacgcgctggatggcaagttcgacagcgacgac
aacgccgcgttccgtcagaagcagctgatcgccatgcgcgacaaaacgcaggaagacgag
accgaagtgaccgcctcggagctggacatcaactacgtcaccatggacggcaacatcggt
tgcatggtcaacggtgccggcctggccatggcgaccatggacgtcatcaagctcaatggc
ggcgagccggcgaacttcctggacgtgggcggcggtgcgaacaagcagcgcgtcatcgaa
gcgttcaagctgatcctgtcctcggacaaggtcgaaggcatcttcgtcaacatcttcggt
ggcatcgtccgctgcgacatgattgccgagggcatcatcgccgcggtcaaggaagtgggc
gtcaaggttccggtcgtggtgcgcctggaaggcaccaacgtggaagaaggcaagcagctg
ctgcgcgatagcggcatggccatcatcccggccgacaacatcaacgacggcgccaagaaa
gtcgttgaagctgtcaagaacgccgcctga

DBGET integrated database retrieval system