KEGG   Xanthomonas oryzae pv. oryzicola: XOC_3700Help
Entry
XOC_3700          CDS       T01873                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XOC_3700
   01230 Biosynthesis of amino acids
    XOC_3700
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOC_3700
   00030 Pentose phosphate pathway
    XOC_3700
   00051 Fructose and mannose metabolism
    XOC_3700
   00052 Galactose metabolism
    XOC_3700
  Energy metabolism
   00680 Methane metabolism
    XOC_3700
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    XOC_3700
Enzymes [BR:xor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     XOC_3700
Protein phosphatases and associated proteins [BR:xor01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     XOC_3700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3805214..3806470
Genome map
AA seq 418 aa AA seqDB search
MTTGNVLYAQSGGVTAVINATAAGVIAEARARKIKVLAARNGILGALREELIDTSKESAA
AIAALAQTPGGAFGSCRYKLKSLEEDSAKYERLLDVLRAHDVRWFLYNGGNDSADTAWKV
SQLAKAYGYPLHCIGVPKTIDNDLAVTDTCPGFGSAAKYTAVSVREVALDVAAMADTSTK
VFIYEAMGRHAGWLAAAAGLAGQGPDDAPQIILLPERAYDQTAFLAKVKQVVDKVGWCVV
VASEGIQNAHGQFVADAGGAADSFGHAQLGGVAAFLAAQVKQELGYKVHWTLPDYLQRSA
RHLASKTDWEQAQAVGKAAVQYALKGMNAVIPVIERVSDTPYRWKIVPAPLHKVANHEKK
MPPSFLRKDGFGITERARRYFAPLIKGEAPLAYGSDGLPTYVTLKNVAVAKKLPAWEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccactggcaacgtgttgtatgcccaatccggcggcgttaccgccgtcatcaacgcc
accgccgccggtgtcatcgccgaagcgcgcgcgcgcaagatcaaggtactggctgcacgc
aacggcatcctgggcgccttgcgcgaggagttgatcgacacctccaaagaatccgccgca
gccattgccgcattggcgcagacacccggcggcgcgttcggctcgtgccgctacaagctc
aaatcgttggaagaggacagcgccaagtacgagcgcctgctcgatgtgctgcgcgcacac
gatgtgcgctggttcctctacaacggcggcaatgattcggccgacaccgcgtggaaggtc
tcgcaactcgcaaaagcctatggctacccactgcactgcatcggcgtacccaagaccatc
gataacgacctggcggtgaccgacacctgccccggcttcggctcggcggccaagtacacc
gccgtctcggtccgcgaggtcgccttggacgtcgccgccatggccgacacctccaccaag
gtcttcatctatgaagccatgggccgccacgccggctggctggccgcagccgcaggcctt
gccgggcaaggccccgacgacgcgccgcagatcatcctgctgcccgaacgcgcctacgac
cagaccgcgtttctggcaaaggtaaagcaggtagtggacaaagtcggctggtgcgtcgtg
gtagccagcgaaggcatccagaacgcgcacggccagttcgtcgccgatgccggcggcgcg
gcggattccttcggccacgcgcagctcggcggcgtggccgcgttcctggccgcacaggtc
aagcaggaactcggctacaaagtgcactggaccttgcccgattacctgcaacgctccgca
cgccacctcgcatcgaagaccgactgggaacaggcccaagccgtcggcaaggccgccgtg
cagtacgccctcaagggcatgaacgcggtgatcccggtgatcgaacgcgtcagcgacacc
ccctaccgctggaagatcgtgcccgcgcccctgcacaaggtggccaaccacgaaaagaaa
atgccgcccagtttcctgcgcaaggacggcttcggcatcaccgagcgcgcccgccgctac
ttcgccccgttgatcaaaggcgaagcgccgctggcctacggcagcgatggtttgccgacg
tatgtgacgttgaagaatgtggcggtggcgaagaagttgccggcgtgggaggggtga

DBGET integrated database retrieval system