KEGG   Xanthomonas oryzae pv. oryzicola: XOC_3725Help
Entry
XOC_3725          CDS       T01873                                 

Definition
L-isoaspartate protein carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Brite
Enzymes [BR:xor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     XOC_3725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3838158..3838814
Genome map
AA seq 218 aa AA seqDB search
MTIDFTQAREKMVEQQIRPWDVLDLRVLDVLARMPREAFVPEAYKTLAYVDVDIPLSAGH
KMMKPVIEGRMLQALDLQPGEDVLEVGTGSGFATACLATLAREVVSLEIDPALAAAARAN
LDRTGLGSNVRIETADVFGWQSERRFDAICVTGAVDTLPVQWLQWLRPNGRLFVVRGHEP
VMEAILARGDVNAPRIESLFETDLAYLQGAAPTPRFQF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgatttcacccaggcccgcgaaaagatggttgagcagcagatccggccgtgg
gacgtgctggacctgcgcgtactcgacgtgctggcgcgcatgccgcgcgaagccttcgtg
ccggaggcctacaagacgctggcctatgtcgacgtggacattccgctgtcggccggtcac
aagatgatgaagccggtcatcgaaggccgcatgttgcaggcgctggatctgcagccgggc
gaagacgtgctggaagtgggcactggcagcggctttgccaccgcctgcctggccacgctc
gcgcgcgaagtcgtcagcctggagatcgacccggcgctggccgccgccgcacgcgccaat
ctggaccgtaccggcctgggtagcaatgtccgtatcgaaaccgccgacgtattcggctgg
cagagcgaacgtcgcttcgatgccatctgcgtgaccggcgccgtcgataccctgcccgtg
cagtggctgcagtggttgcgcccgaacggccggctgtttgtcgtgcgcggtcacgaaccg
gtgatggaagcgatcctggcccggggcgacgtcaacgcaccgcgcatcgaatcgttgttc
gaaaccgacctcgcctatctccagggggccgcaccgacgccccgattccagttctga

DBGET integrated database retrieval system