KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_3725Help
Entry
XOC_3725          CDS       T01873                                 

Definition
(GenBank) L-isoaspartate protein carboxylmethyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Brite
Enzymes [BR:xor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     XOC_3725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_31 Methyltransf_11 CMAS MTS Methyltransf_23 PrmA Methyltransf_12 NodS GCD14 Methyltransf_24 Methyltransf_18 GidB Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: AEQ97815
UniProt: G7TFR6
Position
3838163..3838819
Genome map
AA seq 218 aa AA seqDB search
MTIDFTQAREKMVEQQIRPWDVLDLRVLDVLARMPREAFVPEAYKTLAYVDVDIPLSAGH
KMMKPVIEGRMLQALDLQPGEDVLEVGTGSGFATACLATLAREVVSLEIDPALAAAARAN
LDRTGLGSNVRIETADVFGWQSERRFDAICVTGAVDTLPVQWLQWLRPNGRLFVVRGHEP
VMEAILARGDVNAPRIESLFETDLAYLQGAAPTPRFQF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgatttcacccaggcccgcgaaaagatggttgagcagcagatccggccgtgg
gacgtgctggacctgcgcgtactcgacgtgctggcgcgcatgccgcgcgaagccttcgtg
ccggaggcctacaagacgctggcctatgtcgacgtggacattccgctgtcggccggtcac
aagatgatgaagccggtcatcgaaggccgcatgttgcaggcgctggatctgcagccgggc
gaagacgtgctggaagtgggcactggcagcggctttgccaccgcctgcctggccacgctc
gcgcgcgaagtcgtcagcctggagatcgacccggcgctggccgccgccgcacgcgccaat
ctggaccgtaccggcctgggtagcaatgtccgtatcgaaaccgccgacgtattcggctgg
cagagcgaacgtcgcttcgatgccatctgcgtgaccggcgccgtcgataccctgcccgtg
cagtggctgcagtggttgcgcccgaacggccggctgtttgtcgtgcgcggtcacgaaccg
gtgatggaagcgatcctggcccggggcgacgtcaacgcaccgcgcatcgaatcgttgttc
gaaaccgacctcgcctatctccagggggccgcaccgacgccccgattccagttctga

DBGET integrated database retrieval system