KEGG   Xanthomonas oryzae pv. oryzicola: XOC_3819Help
Entry
XOC_3819          CDS       T01873                                 

Definition
DNA polymerase III holoenzyme chi subunit
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    XOC_3819
   00240 Pyrimidine metabolism
    XOC_3819
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    XOC_3819
   03430 Mismatch repair
    XOC_3819
   03440 Homologous recombination
    XOC_3819
Enzymes [BR:xor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     XOC_3819
DNA replication proteins [BR:xor03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     XOC_3819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3950398..3950823
Genome map
AA seq 141 aa AA seqDB search
MPRADFYLIAKPRFLNEPLRLVCELARKANDANLSTLILARDAEQAEALDDLLWAFDDEA
YVPHQIAGTDEEDELAPVLIAAPEFAAPSRPLVINLRDDPYLGACDRVLEVVPADPAARE
PLRERWKQYKALGLELTKYDM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtgccgacttctacctgatcgccaagccgcgctttctcaacgaaccgctgcgg
ctggtgtgcgagctggcgcgcaaggccaacgacgccaacctgtcgacgctgatcctggcc
cgcgatgcggagcaggccgaggcgttggacgacctgctgtgggcgttcgacgacgaagcc
tacgtgccgcaccagatcgccggcaccgatgaggaagacgagctggccccggtgctgatc
gccgcccccgagttcgccgctccctcgcgcccgctggtgatcaacctgcgcgacgacccg
tacctgggcgcctgcgaccgcgtgctggaagtggtgcccgccgacccggccgcccgcgaa
ccgctgcgcgagcgttggaaacagtacaaggccttgggcctggaactgaccaagtacgac
atgtga

DBGET integrated database retrieval system