KEGG   Xanthomonas oryzae pv. oryzicola: XOC_3841Help
Entry
XOC_3841          CDS       T01873                                 

Gene name
xanA
Definition
phosphohexose mutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOC_3841 (xanA)
   00030 Pentose phosphate pathway
    XOC_3841 (xanA)
   00051 Fructose and mannose metabolism
    XOC_3841 (xanA)
   00052 Galactose metabolism
    XOC_3841 (xanA)
   00500 Starch and sucrose metabolism
    XOC_3841 (xanA)
   00520 Amino sugar and nucleotide sugar metabolism
    XOC_3841 (xanA)
  Nucleotide metabolism
   00230 Purine metabolism
    XOC_3841 (xanA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XOC_3841 (xanA)
Enzymes [BR:xor01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XOC_3841 (xanA)
    5.4.2.8  phosphomannomutase
     XOC_3841 (xanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3975276..3976622
Genome map
AA seq 448 aa AA seqDB search
MTLPAFKAYDIRGRVPDELNEDLARRIGVALAAQLDQGPVVLGHDVRLASPALQEALSAG
LRASGRDVIDIGLCGTEEVYFQTDYLKAAGGVMVTASHNPMDYNGMKLVREQARPISSDT
GLFAIRDTVAADTAAPGEPTASEQSRTDKTAYLEHLLSYVDRSTLKPLKLVVNAGNGGAG
LIVDLLAPHLPFEFVRVFHEPDGNFPNGIPNPLLPENRDATAKAVKDHGADFGIAWDGDF
DRCFFFDHTGRFIEGYYLVGLLAQAILAKQPGGKVVHDPRLTWNTVEQVEEAGGIPVLCK
SGHAFIKEKMRNENAVYGGEMSAHHYFREFAYADSGMIPWLLIAELVSQSGRSLADLVEA
RMQKFPCSGEINFKVADAKASVARVMEHYASLSPELDDTDGISADFGEWRFNLRSSNTEP
LLRLNVETRGDAALLETRTQEISNLLRG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgacgctacccgccttcaaggcctacgatattcgcggccgcgtgccggatgaactcaac
gaggacttggcacgccgtatcggcgtggcactggcggcacagctggatcaggggccggtg
gtcctgggccacgatgtgcgcctggccagcccggcgttgcaggaagcgctttccgccggc
ctgcgtgccagcggccgtgacgtgatcgatatcggtctgtgcggcaccgaggaagtctat
ttccagaccgattacctcaaggccgccggcggcgtgatggtcaccgccagccacaacccg
atggactacaacggcatgaagctggtgcgtgagcaagcgcggccgatcagctcggacacc
ggcctgttcgccatccgcgacacggtcgccgctgataccgccgcacccggcgagcccacc
gccagtgagcagagccgcaccgacaagaccgcgtacctggagcacctgctcagctacgtg
gaccgcagcaccctcaagccgctcaagctggtggtcaacgccggcaacggcggcgccggg
ctgatcgtcgatctgctcgcgccgcatctgccgttcgaattcgtgcgcgttttccacgag
cccgatggcaacttccccaacggcatccccaatccgctgctgccggagaaccgcgatgcg
accgccaaggcagtcaaggaccatggcgccgatttcggcatcgcgtgggacggcgacttc
gatcgctgcttcttcttcgatcacacaggccgcttcatcgaaggctattacctggtcggc
ctgctcgcccaagccatcctggccaaacagccgggcggcaaggtcgtgcacgacccgcgc
ctgacctggaacacggtcgagcaggtcgaagaggccggcggcattccggtgctgtgcaag
agcggccacgccttcatcaaggaaaaaatgcgcaacgaaaatgccgtctatggcggcgaa
atgagcgcgcaccattatttccgtgagttcgcctatgccgactccggcatgattccgtgg
ctgctgatcgcagagctggtgtcgcagtcgggccgttcgctggccgatctggtcgaagca
cgcatgcagaaattcccctgtagcggcgagatcaacttcaaggtcgccgatgccaaggca
tcggttgcgcgcgtgatggagcattacgcctcgctgtctccggagctcgacgacaccgac
ggcattagtgccgattttggtgaatggcgtttcaatttgcgtagttccaacaccgagccg
ctgctgcgcctgaacgtggaaacgcgcggcgatgccgcactgctggaaacgcgtacgcag
gaaatttccaacctgctgcgcggctga

DBGET integrated database retrieval system