KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_3844Help
Entry
XOC_3844          CDS       T01873                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
xor00521  Streptomycin biosynthesis
xor00523  Polyketide sugar unit biosynthesis
xor01130  Biosynthesis of antibiotics
Module
xor_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    XOC_3844 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XOC_3844 (rfbC)
Enzymes [BR:xor01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     XOC_3844 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AEQ97934
UniProt: G7TGZ3
Position
complement(3979100..3979657)
Genome map
AA seq 185 aa AA seqDB search
MKIVETRLPGCVVIEPAVFGDERGYFFETWNAERFGQHGLPTQFVQSNVSTSAKGVLRGL
HYQWPRPQGKLVSVLEGEVYDVAVDVRHGSPNFGQWAAVVLSAENNKQFWIPEGFAHGFA
VLSERAVFSYLCTDVYVKEADAGVRWDDAAIGIDWPISDPLLSAKDAAAPFLADVPAERL
PVYTP
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcgtcgaaacgcgtttaccaggttgtgtcgtcatcgagccggcagtgttcggc
gatgagcgcggatatttcttcgaaacgtggaatgccgagcgcttcgggcaacatggtctg
ccgacgcagttcgtgcagagcaatgtctccacctcggccaaaggcgtgttgcgtggtttg
cattaccagtggccgcgtcctcagggcaagctggtcagcgtgctggagggtgaggtctac
gacgtggcggtcgatgtccgccatggctcgcccaacttcgggcagtgggcggcagtggtg
ttgagcgcagaaaacaacaagcagttctggataccggaagggtttgcgcacggctttgcg
gtgctgtcggagcgagccgtgttcagttacctgtgcaccgacgtgtatgtgaaggaggcc
gatgccggcgtgcgctgggatgatgcggcgatcggtatcgattggccgatcagcgatcca
ttgctctctgcaaaggacgccgctgcgccgtttctggccgatgtgcccgctgagcgcttg
ccggtgtatacaccgtga

DBGET integrated database retrieval system