KEGG   Xanthomonas oryzae pv. oryzicola: XOC_4001Help
Entry
XOC_4001          CDS       T01873                                 

Definition
methyltransferase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:xor00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XOC_4001
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    XOC_4001
Enzymes [BR:xor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     XOC_4001
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     XOC_4001
Two-component system [BR:xor02022]
 CheA family
  CheA-CheYBV
   XOC_4001
Bacterial motility proteins [BR:xor02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    XOC_4001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4131748..4133211)
Genome map
AA seq 487 aa AA seqDB search
MLHGGLPCVARSSPIAPELSVANDRAAMTDDEISSTETAPDIAAQPPLFVLGVGAARLDA
DRLAELLDAVAGAATLAIMLLLRDRQLLDEAHLRALRGKQATLLSVPFDGEKLQPGRFYL
PPADTAVTLEEGRIRLRTLPNGESDHGLIDSFFVTMAHDQDGNVIGLIMGRFDVDGTLGT
AAIKQCGGLALAVDDASLHGLDLRSANNPAAITDDILPLPQVAARIAAHMQRHHGFGHPV
PLGLRNGSESDKLSQIAAILRNTTGHDFHGYKRATFLRRVQQRMQVAQVEMLEQYLHILR
YRFDEPLQLFNDLLIGVTKFFRGRREFEFLAQQVIPRLLQGKHTGDSLRVWVLGCSTGEE
AYSLAMLLRDHAETLDSAPRIQIFASDIDGRALATARVGRHASSIVGEVAPERLRRWFVK
EGDTYVVNKELRELCVFSQHSIVKDPPFSRLDLVSCRNLLIYLDAELKNRVIPIFHFAIR
PGGYLFS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcatggcggtctgccgtgcgttgcgcgatcatcgccgattgcgcctgagctcagc
gttgcgaacgatcgtgccgccatgaccgacgacgaaatttccagcaccgagaccgcccct
gacatcgccgcgcagccgcccttattcgtgctgggcgtgggcgccgcgcggcttgatgca
gaccgcttggcggaattgctcgatgcggtagcaggcgctgcgactctggcgatcatgctg
ctgctgcgcgatcgccagttgctggacgaggcgcacctgcgcgcattgcgtggtaaacag
gccacgctgttgtcggtgcccttcgatggcgagaaattgcagccagggcgcttctatcta
ccgcccgccgataccgcggtcacgctggaggaagggcgtatccgcctgcggacattgccc
aacggcgaaagcgaccacgggttgatcgacagtttcttcgtgacgatggcgcacgatcag
gacggcaatgtgatcggtctgatcatggggcgtttcgacgtcgacggcacgctgggcacg
gcagcgatcaagcaatgcggcggcctggcgctggccgtggacgatgcctcgctgcatggg
ctggatctgcgcagcgccaataatccggctgccatcaccgacgacatcctgccgctgcca
caagtggctgcacgcatcgctgcgcacatgcagcgtcaccacggcttcggtcatccggta
ccgctgggcctgcgcaatggcagcgagagcgacaagctcagccagattgccgcgatcctg
cgcaataccaccggccacgattttcacggttataaacgcgccacgttcctgcgtcgcgtg
cagcagcgcatgcaggtcgcgcaggtggaaatgctggagcagtatctgcacatcctgcgc
taccgcttcgacgagccgttgcagctgttcaacgacctgctgatcggcgtgaccaagttc
tttcgcggccgccgcgaattcgaattcctcgcgcagcaggtgatcccgcggttgttgcag
ggcaagcacaccggcgacagcctgcgcgtctgggtgctgggttgctccaccggcgaagaa
gcctattcgctggcgatgctgctgcgcgaccatgccgaaaccctggacagcgcgccacgt
atccagatcttcgccagcgatatcgacgggcgtgcgctggccaccgcgcgggtggggcgc
catgcctccagcatcgtgggcgaggttgcgcctgagcgcttgcggcgctggttcgtcaag
gaaggcgacacctatgtggtgaacaaggaactgcgcgagctgtgcgtgttctcccagcac
agtatcgtcaaggatccgccgttttcgcggctggatctggtgtcgtgccgcaatctgctg
atctatctggatgccgaattgaagaatcgggtcatcccgatctttcatttcgccatccgc
ccgggcggctatctgttttcctga

DBGET integrated database retrieval system