KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_4204Help
Entry
XOC_4204          CDS       T01873                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
xor00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xor01100  Metabolic pathways
xor01110  Biosynthesis of secondary metabolites
xor01130  Biosynthesis of antibiotics
xor01230  Biosynthesis of amino acids
Module
xor_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XOC_4204 (trpC)
Enzymes [BR:xor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     XOC_4204 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEQ98280
UniProt: G7TKE1
Position
complement(4357100..4357972)
Genome map
AA seq 290 aa AA seqDB search
MLRGMQLRSSAVVLTDNARPPGPNTMSDILNTILARKADEVAERSARVPLAELIARSADL
PLTRGFAAAMQASIAAGDPAVIAEVKKASPSKGVIRPDFHPADIAVSYEFGGATCLSVLT
DVDFFQGSDAYLRQARDACTLPVLRKDFTVDPYQVYEARVLGADCILLIVSALEDAQLAD
LSGLAMQLGLDVLVEVHDIDELERAVQVPVPLIGINNRNLRTFEVTLQTTLDMRAAVPRD
RVLVTESGIVTQADVQLMRSNDVNAFLVGETFMRAAEPGESLRQLFFAHD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcggcatgcagctgcgctccagtgcggttgtcttgaccgataatgcccgaccg
ccaggacccaatacgatgagcgacatcctcaacaccattcttgcccgcaaggccgacgaa
gtcgccgagcgcagtgcgcgcgtgccgctggccgagttgatcgcgcgcagcgccgacctg
ccgctcacccgcggttttgcggctgccatgcaggccagcatcgccgccggcgatccggcc
gtgattgccgaagtgaagaaggccagcccgtccaagggcgtgatccggcccgacttccat
ccggccgatatcgcggtcagctatgagttcggcggcgcgacgtgcctgtcggtgctcacc
gatgtggatttcttccagggatccgatgcctatctaaggcaggcgcgcgacgcctgcacc
ctgccggtgctgcgcaaggatttcaccgtcgacccgtatcaggtctatgaagcccgcgtg
ctcggtgccgactgcatcctgttgatcgtctccgcattggaagatgcccaattggccgat
ttgtcggggctggccatgcagctgggcctggacgtgctggtggaagtgcacgatatcgac
gagctcgagcgtgcggtgcaggtgccggtgccgttgatcggcatcaacaatcgcaacctg
cgcacgttcgaggtcacgctgcagaccactctggacatgcgcgccgcggtgccgcgcgac
cgcgtgctggttaccgaaagcggcatcgtcacccaggccgatgtgcaactgatgcgcagc
aacgatgtgaacgcatttctggttggcgagaccttcatgcgcgcggccgagcccggcgag
tcactgcgtcagctattcttcgcgcatgactga

DBGET integrated database retrieval system