KEGG   Xanthomonas oryzae pv. oryzicola: XOC_4204Help
Entry
XOC_4204          CDS       T01873                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xor01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:xor00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4357093..4357965)
Genome map
AA seq 290 aa AA seqDB search
MLRGMQLRSSAVVLTDNARPPGPNTMSDILNTILARKADEVAERSARVPLAELIARSADL
PLTRGFAAAMQASIAAGDPAVIAEVKKASPSKGVIRPDFHPADIAVSYEFGGATCLSVLT
DVDFFQGSDAYLRQARDACTLPVLRKDFTVDPYQVYEARVLGADCILLIVSALEDAQLAD
LSGLAMQLGLDVLVEVHDIDELERAVQVPVPLIGINNRNLRTFEVTLQTTLDMRAAVPRD
RVLVTESGIVTQADVQLMRSNDVNAFLVGETFMRAAEPGESLRQLFFAHD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcggcatgcagctgcgctccagtgcggttgtcttgaccgataatgcccgaccg
ccaggacccaatacgatgagcgacatcctcaacaccattcttgcccgcaaggccgacgaa
gtcgccgagcgcagtgcgcgcgtgccgctggccgagttgatcgcgcgcagcgccgacctg
ccgctcacccgcggttttgcggctgccatgcaggccagcatcgccgccggcgatccggcc
gtgattgccgaagtgaagaaggccagcccgtccaagggcgtgatccggcccgacttccat
ccggccgatatcgcggtcagctatgagttcggcggcgcgacgtgcctgtcggtgctcacc
gatgtggatttcttccagggatccgatgcctatctaaggcaggcgcgcgacgcctgcacc
ctgccggtgctgcgcaaggatttcaccgtcgacccgtatcaggtctatgaagcccgcgtg
ctcggtgccgactgcatcctgttgatcgtctccgcattggaagatgcccaattggccgat
ttgtcggggctggccatgcagctgggcctggacgtgctggtggaagtgcacgatatcgac
gagctcgagcgtgcggtgcaggtgccggtgccgttgatcggcatcaacaatcgcaacctg
cgcacgttcgaggtcacgctgcagaccactctggacatgcgcgccgcggtgccgcgcgac
cgcgtgctggttaccgaaagcggcatcgtcacccaggccgatgtgcaactgatgcgcagc
aacgatgtgaacgcatttctggttggcgagaccttcatgcgcgcggccgagcccggcgag
tcactgcgtcagctattcttcgcgcatgactga

DBGET integrated database retrieval system