KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_4304Help
Entry
XOC_4304          CDS       T01873                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XOC_4304 (rocF)
  Amino acid metabolism
   00220 Arginine biosynthesis
    XOC_4304 (rocF)
   00330 Arginine and proline metabolism
    XOC_4304 (rocF)
Enzymes [BR:xor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     XOC_4304 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4445263..4446186)
Genome map
AA seq 307 aa AA seqDB search
MATQYVPVSLIGVPTDIGAGHRGARMGPEALRIAGLHEALVSRGVEVRDLGNLDGPRNPW
QAPQAGYRHLDEVVAWNQALMDASYAELRAGRMPIMLGGDHCLGIGSITAVAKYCREQGR
PLRVLWLDAHSDFNTSEVTPSGNVHGMPVACLCGLGPETLTHLGGSAPALLPEQVRQIGI
RSVDPEEKRLIKQHRIDVYDMRYIDEAGMKRTMEAALQDMSADTHLHVSFDVDFLDPSIA
PGVGTTVPGGPNYREAQLVMEMIADTGRMGSLDIVELNPVLDNRNATAELAVDLVESLFG
KSTLMRD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcagtacgtgccggtttccctgattggcgttcccaccgacatcggcgccggc
caccgcggcgcgcgcatgggaccggaggcgctacgcatcgccggactgcacgaggccctg
gtcagccgcggcgtggaggtgcgcgacctgggcaacctggatggcccgcgcaatccctgg
caggcaccgcaagccggctaccggcatctggacgaagtagtggcctggaaccaggcgctg
atggacgccagctacgccgaactgcgtgccggacgcatgccgatcatgctcggtggcgac
cattgcctgggcatcggctccatcaccgcggtggccaagtactgccgcgagcagggccgg
ccgttgcgggtgctgtggctggatgcgcactcggacttcaacaccagcgaggtgacgccc
tcgggcaatgtgcacggcatgccggtggcctgtctgtgcgggctgggcccggagacgctg
acccatctgggcggcagtgcgccggcgctgttgcccgagcaggtacggcagatcggcatc
cgctcggtggacccggaggagaagcggctgatcaagcagcaccgcatcgatgtctacgac
atgcgctacatcgacgaagccggcatgaagcgcaccatggaggccgcgttgcaggacatg
agtgccgacacgcacctgcatgtgagcttcgatgtggacttcctcgaccccagcatcgcg
cctggcgtgggcaccaccgtgcccggtggccccaactaccgcgaggcgcagctggtgatg
gagatgatcgccgacaccgggcgcatggggtcgttggacatcgtcgagctcaacccggtg
ctggacaaccgcaacgcgaccgccgaactggcggtggatctggtcgaaagcctgttcggc
aaatcgacgctgatgcgtgattga

DBGET integrated database retrieval system