KEGG   Xanthomonas oryzae pv. oryzicola: XOC_4304Help
Entry
XOC_4304          CDS       T01873                                 

Gene name
rocF
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xor01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:xor00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4445256..4446179)
Genome map
AA seq 307 aa AA seqDB search
MATQYVPVSLIGVPTDIGAGHRGARMGPEALRIAGLHEALVSRGVEVRDLGNLDGPRNPW
QAPQAGYRHLDEVVAWNQALMDASYAELRAGRMPIMLGGDHCLGIGSITAVAKYCREQGR
PLRVLWLDAHSDFNTSEVTPSGNVHGMPVACLCGLGPETLTHLGGSAPALLPEQVRQIGI
RSVDPEEKRLIKQHRIDVYDMRYIDEAGMKRTMEAALQDMSADTHLHVSFDVDFLDPSIA
PGVGTTVPGGPNYREAQLVMEMIADTGRMGSLDIVELNPVLDNRNATAELAVDLVESLFG
KSTLMRD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcagtacgtgccggtttccctgattggcgttcccaccgacatcggcgccggc
caccgcggcgcgcgcatgggaccggaggcgctacgcatcgccggactgcacgaggccctg
gtcagccgcggcgtggaggtgcgcgacctgggcaacctggatggcccgcgcaatccctgg
caggcaccgcaagccggctaccggcatctggacgaagtagtggcctggaaccaggcgctg
atggacgccagctacgccgaactgcgtgccggacgcatgccgatcatgctcggtggcgac
cattgcctgggcatcggctccatcaccgcggtggccaagtactgccgcgagcagggccgg
ccgttgcgggtgctgtggctggatgcgcactcggacttcaacaccagcgaggtgacgccc
tcgggcaatgtgcacggcatgccggtggcctgtctgtgcgggctgggcccggagacgctg
acccatctgggcggcagtgcgccggcgctgttgcccgagcaggtacggcagatcggcatc
cgctcggtggacccggaggagaagcggctgatcaagcagcaccgcatcgatgtctacgac
atgcgctacatcgacgaagccggcatgaagcgcaccatggaggccgcgttgcaggacatg
agtgccgacacgcacctgcatgtgagcttcgatgtggacttcctcgaccccagcatcgcg
cctggcgtgggcaccaccgtgcccggtggccccaactaccgcgaggcgcagctggtgatg
gagatgatcgccgacaccgggcgcatggggtcgttggacatcgtcgagctcaacccggtg
ctggacaaccgcaacgcgaccgccgaactggcggtggatctggtcgaaagcctgttcggc
aaatcgacgctgatgcgtgattga

DBGET integrated database retrieval system