KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_4340Help
Entry
XOC_4340          CDS       T01873                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
xor00860  Porphyrin and chlorophyll metabolism
xor01100  Metabolic pathways
xor01110  Biosynthesis of secondary metabolites
xor01120  Microbial metabolism in diverse environments
Module
xor_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XOC_4340 (hemB)
Enzymes [BR:xor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     XOC_4340 (hemB)
Exosome [BR:xor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XOC_4340 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD TP_methylase
Motif
Other DBs
NCBI-ProteinID: AEQ98412
UniProt: G7TM56
Position
complement(4478132..4479124)
Genome map
AA seq 330 aa AA seqDB search
MAHPHYRPRRMRHDAFSRRLMRENTLTTDDLIWPVFVHALSGRAPIASMPGVERLSLEEL
LREAENALELGIPVIDLFPVIDPAGKSLDAAEAWNPDGLAQRAVRALKSRFPELGVMTDV
ALDPYTTHGQDGIIDDKGYVLNEITVEALVKQSLSHAQAGVDIISPSDMMDGRIGAIRRA
LDADDHLNVRIMAYSAKYASAFYGPFRDAVGSAGNLGKADKTTYQMDPANGDEALREIAL
DLEEGADMVMVKPGMPYLDVVRRVKEEFRVPTFAYQVSGEYAMLKAASANGWLDERKCVL
EALMAFKRAGADGVLTYFAPQVARWLRETR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcccacccgcactatcgtccccgccgcatgcgccacgatgcgttttcgcgccggttg
atgcgcgaaaacacgctgaccaccgatgacctgatctggccggtgttcgtgcacgccttg
tccggccgcgcgccgattgcgtcgatgccgggcgtggaacgcctgtcgctggaggagttg
ctgcgcgaagcggaaaacgcgctggaactgggcatcccggtgatcgatctgtttccggtg
atcgacccggccggcaagagcctggacgctgccgaagcctggaacccggacggcctggcg
cagcgcgcggtacgtgcgttgaagtcgcgctttccggagctgggggtgatgaccgacgtg
gcgctggacccgtacaccacccacgggcaggacggcatcatcgatgacaagggctatgtg
cttaacgagatcaccgtcgaggccctggtcaagcaatcgttgtcgcatgcgcaggcgggc
gtggacatcatttcgccttcggacatgatggacggccgcatcggtgcgatccgccgcgcg
ctcgatgccgacgatcatctcaacgtgcggatcatggcgtattcggccaagtatgcctcg
gcgttctacggcccgttccgcgatgccgtgggcagcgccggcaatcttggcaaggccgac
aagaccacctatcaaatggacccggccaacggtgacgaagccttgcgcgagatcgccctg
gatctggaagaaggcgcggacatggtgatggtcaagccgggcatgccgtatctggatgtg
gtgcgccgggtgaaggaagaattccgcgtgccgacctttgcgtatcaggtcagcggcgag
tacgcgatgctcaaggcggcctcggccaatggctggctggatgagcgcaagtgcgtgctt
gaggcgttgatggccttcaagcgtgccggtgccgatggcgtgctgacctatttcgccccg
caagtggcgcgctggttgcgcgaaacgcgctga

DBGET integrated database retrieval system