KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_4416Help
Entry
XOC_4416          CDS       T01873                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XOC_4416 (glgB)
Enzymes [BR:xor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     XOC_4416 (glgB)
Exosome [BR:xor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XOC_4416 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4548769..4550928)
Genome map
AA seq 719 aa AA seqDB search
MSQTLQALADGLPANAFAVLGPHPLADGRCQVRVLAPGAEAMWLIDPRGKLLARMQASAI
DGVFEGILAIEGRYRLRIVWPDMVQEIEDPYAFAATLDESLLLQIAAGDGQALRRALGAQ
HVQCCEVPGVRFAVWAPHAQRVAVVGDFNGWDVRRHPMRQRIGGFWELFLPRVEAGARYK
YAVTAADGRMLLKADPVARQTELPPATASVVHGTATFAWTDAAWMAKRDPSAMPVPLSIY
EVHAASWRRDGHHQPLDWPTLAEQLISYVQQLGFTHIELLPITEHPFGGSWGYQPLGRYA
PTARHGSPDGFAQFVDACHRAGIGVILDWVSVHFPDDAHGLAQFDGAALYEHADPREGMH
RDWNTLIYNYGRPEVTAYLLGSALEWIDHYHLDGLRVDAVASMLYRDYGRAEGEWVPNAH
GGRENLEAVAFLRQLNREIAAHFPGVLTIAEESTAWPGVTAAISDGGLGFTHKWNMGWMH
DTLSYMQRDPAERAHHHSQLTFGLVYAFDERFVLPISHDEVVHGTGGLLGQMPGDDWRRF
ANLRAYLALMWAHPGDKLLFMGTEFGQWADWNHDQSLDWHLLEGARHRGVQLLVGDLNAT
LRRTPALYRGTHRAEGFDWSVADDARNSVLAFIRHDPDGGVPLLAVSNLTAQPLHDYGVG
VPRAGAWREILNTDSGHYGGSNLGNSGRLATEPMGMHGHAQRLRLTLPPLATIYLQAEK
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaccctgcaagcgctggccgatggattgccggccaacgcctttgcggtcctt
gggccgcacccgctcgccgatgggcgctgccaggtgcgtgtgctggcgccgggcgccgag
gcgatgtggttgatcgacccgcgcggcaagttgctggcacgcatgcaggccagcgcgatc
gacggcgtctttgaaggcatcctggcgatcgaagggcggtaccggctgcgcatcgtgtgg
ccggacatggtgcaggagatcgaagacccgtacgcgttcgcggccacgctggacgaatcg
ctgttgctgcagatcgccgctggcgatggccaggcgctgcgccgcgcgctgggcgcgcag
catgtgcaatgttgcgaagtgcccggcgtgcgctttgcagtgtgggcaccgcatgcgcaa
cgcgtggccgtggttggcgacttcaatggctgggacgtgcggcgacacccgatgcggcag
cgtatcggcggcttctgggaactgtttctgccgcgcgtggaagctggcgcgcgctacaag
tacgccgtcactgcagccgatggccgcatgctgctcaaggccgacccggtggcgcggcaa
accgaattaccgccggccaccgcctcggtggtgcacggcacggccacctttgcgtggacc
gacgcggcctggatggccaagcgcgatcccagcgccatgccggtgccgctgtcgatctac
gaagtgcatgccgcgtcctggcgccgcgacggacatcaccagccgctggactggccaacc
ctggccgagcagttgatttcctacgtgcagcagctcggcttcacgcatatcgaattgctg
ccgatcaccgagcacccgttcggcggttcctggggctaccagccgttgggccggtatgcg
cccaccgcccgccacggcagcccggacgggtttgcgcagttcgtcgacgcctgccaccgc
gctggcatcggcgtgatcctggactgggtcagcgtgcacttccccgatgacgcacatggg
ctggcgcagttcgacggcgccgcgctgtatgagcacgccgaccctcgggaaggcatgcat
cgcgactggaacaccctgatctacaactacggccggcccgaagtgaccgcctacctgctg
gggagcgcgctggagtggatcgaccattaccatctcgacggcctgcgcgtggatgcggtg
gcctcgatgctgtaccgcgactacggccgtgccgaaggcgagtgggtgcccaacgcgcat
ggcggccgcgagaatctggaggcagtggcgttcctgcgtcagctcaaccgcgagatcgcc
gcacacttccccggcgtgctcaccatcgccgaagaatccaccgcctggccgggcgtgacc
gcggcgatcagcgatggcggcctgggcttcacgcacaaatggaacatgggctggatgcac
gacacgctgagctatatgcagcgcgatccagccgaacgtgcgcatcaccatagccagctc
accttcgggctggtgtacgcattcgacgagcggttcgtcttacccatctcgcacgatgaa
gtggtgcacggcaccggtggcttgctcgggcagatgccgggcgacgactggcgccgcttc
gccaacctgcgcgcgtatctggcgctgatgtgggcgcacccgggcgacaaactgctgttc
atgggcaccgaattcggtcaatgggccgattggaatcatgaccagtcgctggattggcat
ctgcttgaaggcgcgcgccaccgcggcgtgcagctactggtgggcgacctcaacgccacg
ttgcgtcgcactcccgcgttgtatcgcggtacccatcgcgccgaaggtttcgactggagc
gtggccgacgacgcgcgcaacagcgtcttggccttcatccgccacgatcctgacggcggc
gtgccgctgctggcagtgagcaacctcaccgcgcaaccgctgcacgactacggcgtgggc
gtgccgcgcgccggcgcctggcgcgaaatcctcaataccgacagtggccattacggtggc
agcaacctcggcaacagcggtcgtcttgcgaccgagccgatgggcatgcatgggcatgcg
caacgcctgcgcctgaccctgccgccgcttgccacgatctatctgcaagcggagaaatag

DBGET integrated database retrieval system