KEGG   Xanthomonas oryzae pv. oryzicola: XOC_4553Help
Entry
XOC_4553          CDS       T01873                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    XOC_4553
Enzymes [BR:xor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     XOC_4553
Exosome [BR:xor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XOC_4553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4696499..4696903
Genome map
AA seq 134 aa AA seqDB search
MLTTIAWGIDGNVEYALEGAVFVAGSVVQWLRDGVRMLGKASDSQASAERAGDNDGVYIV
PAFVGLGAPYWRSDIRGAVFGLTRGTTKEHFVGAAVESMAYRTRDVLTAMQRDSGIGLKE
LRADGGTIANELMA
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaccacgattgcctggggcatcgacggcaacgtcgaatacgcattggaaggtgcc
gtcttcgtcgccggctcggtggtgcagtggctacgcgatggcgtgcgcatgttgggcaag
gccagcgattcgcaggcctctgccgaacgcgccggcgacaacgacggtgtgtatatcgtg
ccggccttcgtcggcctgggcgcgccgtactggcgcagcgacatccgcggcgcggtgttc
gggctgacgcgtggcaccaccaaggaacacttcgtgggtgcggcagtcgaatcgatggcc
taccggacccgcgacgtactcactgcgatgcagcgcgattccggaatcggactgaaagaa
ctgcgtgccgacggcggcaccatcgccaacgaactcatggcgtag

DBGET integrated database retrieval system