KEGG   Xanthomonas oryzae pv. oryzicola: XOC_4581Help
Entry
XOC_4581          CDS       T01873                                 

Definition
glycosyl transferase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Brite
Enzymes [BR:xor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     XOC_4581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4721922..4722692
Genome map
AA seq 256 aa AA seqDB search
MGQCESDARPDDWSTLDAAYRFAQANGMPFQMHVMMWGNQQPEWIKSLRAVEQRREIAPW
FATVAQRYPDIALLEVVNEPLNDPPSKADTGGGNYLQAFRLARQHVPHTKRMINDYSITN
SAQATQKYLQIVRLLQREHLLDAIGVQKRAFETTPNVAMSVHRDNLDALAATCLPIYITE
FDLDGPTDTQQLADYQRVFPLFWERPAMHGITLWGFRPGMWRDKEAAYLIRADGTERPAL
TWLRDYVAAHPGTPTP
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggggcagtgtgaaagcgatgcgcgaccagatgattggagcacgctggatgctgcttac
cggtttgcgcaagccaacggcatgccgttccagatgcacgtgatgatgtggggcaaccag
cagccggagtggatcaagagcttgcgggcggtcgaacagcgccgcgagatcgcgccatgg
tttgccactgttgcgcagcgctacccggacatcgcgctgctggaggtggtgaacgaaccg
ctcaacgacccgccgagcaaggccgataccggtggcggcaattatctgcaggcgtttcgg
cttgcgcgccagcatgtcccgcacaccaagcggatgatcaacgactacagcatcaccaat
agtgcgcaggccacacagaaatatcttcagatcgtgcggttgctgcagcgcgagcacttg
ctcgatgccatcggcgtgcagaagcgcgccttcgagaccacaccgaatgtggcgatgtcg
gtgcatcgcgacaatctggatgcgttggctgccacctgtttgccgatctacatcaccgag
ttcgatctggacgggcccaccgatacgcagcagctggccgactaccagcgcgtgtttccg
ctgttctgggagcgcccggccatgcatggcatcaccttgtggggctttcggcccggcatg
tggcgcgacaaggaagctgcctacctgatccgcgccgatggcaccgaacgtcccgcgctc
acgtggctgcgcgactacgttgcagcccatcccggcacacctacgccatga

DBGET integrated database retrieval system