KEGG   Xenorhabdus poinarii: XPG1_0069Help
Entry
XPG1_0069         CDS       T03805                                 

Definition
(GenBank) protein of unknown function
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xpo  Xenorhabdus poinarii
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:xpo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    XPG1_0069
   00630 Glyoxylate and dicarboxylate metabolism
    XPG1_0069
   00640 Propanoate metabolism
    XPG1_0069
   00650 Butanoate metabolism
    XPG1_0069
  Lipid metabolism
   00071 Fatty acid degradation
    XPG1_0069
   00072 Synthesis and degradation of ketone bodies
    XPG1_0069
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XPG1_0069
   00310 Lysine degradation
    XPG1_0069
   00380 Tryptophan metabolism
    XPG1_0069
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XPG1_0069
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XPG1_0069
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XPG1_0069
Enzymes [BR:xpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XPG1_0069
Exosome [BR:xpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XPG1_0069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(80222..80458)
Genome map
AA seq 78 aa AA seqDB search
MELQSFAAQALAVSHSCGIPAERINPYGGAIALGHTIGASGCRIRVTLIHGLIRENCNKG
IAALCIGGGEGIALSVTR
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
ttggaacttcagtcattcgcagcacaggctctagctgtttctcattcctgcggtattcct
gctgaacgcataaatccttatggtggagcaatcgcactagggcacaccattggcgcctct
ggatgtcggatacgtgtaacattaatacacggactcattcgagaaaattgcaataaagga
attgcggcgctgtgcatcggtggaggggaaggcattgctttgagtgtcactcgctaa

DBGET integrated database retrieval system