KEGG   Xenopus tropicalis (western clawed frog): 100036594Help
Entry
100036594         CDS       T01011                                 

Gene name
cyp19a1, aro, aromatase, cyp19
Definition
cytochrome P450, family 19, subfamily A, polypeptide 1 (EC:1.14.14.1)
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100036594 (cyp19a1)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     100036594 (cyp19a1)
Cytochrome P450 [BR:xtr00199]
 Cytochrome P450, animal type
  CYP19 family
   100036594 (cyp19a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 500 aa AA seqDB search
MEALNPVQYNSTEAVPTLAPATTVSLLLFIFLLIILWNQEETCLIPGPAYCMGLGPLISY
GRFLLTGIGKAANYYNNMYGEFVRVWINGEETLVISKASATFHIMKHSHYISRFGSKLGL
QCIGMNENGIIFNSNPSLWKVIRPFFIKALSGPGLMQTTEICIRSTKRYLDNLGNVTNEL
GNVDVLKLMRLIMLDTSNNLFLRIPLDENEIVLKIQKYFDAWQALLLKPDIFFKISWLYK
KYEKSANDLKEAIEILIEQKRQKLSSSEKLDENMDFASELIFAQNHGDLTAENVNQCILE
MLIAAPDTMSVSLFFMLVLVAQHPKIEEGIMNEIDNVIGDRDVESNDIPNLKVLENFIYE
SMRYQPVVDLVMRKALEDDMIDGYYVKKGTNIILNLGRMHRIEYFPKPNEFTLENFEKTV
PYRYFQPFGSGPRACAGKYIAMVMMKVILVTLFKRYKVQTLGGRCLENIQNNNDLSMHPD
ESQPCLEMIFIPKNTAELKQ
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaagccttgaatcccgtgcagtataacagcacagaggctgttcctactctcgcacct
gccactacggtttctctcctgctcttcatttttttgcttatcattctatggaatcaagag
gagacctgtctgataccaggcccagcctattgcatggggcttgggcccctcatttcttat
ggccgttttctactgacaggaattggcaaagcagcaaattactacaacaacatgtacggg
gaatttgtcagagtctggattaatggcgaggaaacactggtaatcagcaaagcttcagca
acttttcacattatgaagcacagccattatatctcacgttttggaagcaaactggggctg
cagtgtattggcatgaatgaaaacggtatcatatttaatagcaacccatctctatggaag
gtcatccgaccattcttcatcaaagctttgtctggtccaggacttatgcaaaccacagaa
atctgtataagatcgacaaaacgctacctggataaccttggcaatgtgacaaatgaactg
ggaaatgtagatgtccttaaactaatgaggcttattatgttagatacatcaaataatctc
ttcttaaggatacctttagatgaaaatgaaattgttcttaaaatccagaaatactttgac
gcctggcaggctctgcttctgaaaccagacatcttctttaaaatttcctggctgtacaag
aaatatgaaaaatcggcaaatgatctgaaggaggctattgaaattctcattgaacaaaaa
agacagaaactctcaagttctgaaaagctggatgaaaatatggattttgcatcagaactt
atttttgcccagaatcatggagatctaacagctgaaaatgtcaatcagtgtattttggaa
atgctgatagctgctcccgataccatgtctgtatctctcttcttcatgttggttctggtt
gctcaacacccaaagatagaagaaggaataatgaatgaaattgataatgttattggtgat
cgggatgtagagagcaacgacattccaaatctcaaagttctggagaattttatttatgag
agcatgaggtaccaaccggttgtagacctggttatgcgcaaggccctggaggacgatatg
attgatggttactatgtgaagaaaggcactaacatcatattaaacttggggcgcatgcac
agaatcgaatactttccaaagccgaatgagttcactttggaaaactttgaaaagacggtt
ccatatcgttactttcagccctttggctctggcccacgtgcttgtgcggggaagtacata
gctatggttatgatgaaagtcattctggttactcttttcaagaggtacaaggtgcagaca
ctgggaggaagatgcttggagaacatccaaaacaacaatgatttgtctatgcaccctgat
gaaagccagccatgcttagagatgattttcattcccaagaacacagcagagctcaaacag
taa

DBGET integrated database retrieval system