KEGG   Xenopus tropicalis (western clawed frog): 100036606Help
Entry
100036606         CDS       T01011                                 

Gene name
usp20, lsfr3a, vdu2
Definition
ubiquitin specific peptidase 20 (EC:3.4.19.12)
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100036606 (usp20)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100036606 (usp20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 884 aa AA seqDB search
MGDAEDFCPHLDSIGEVTKEDLILKSKGTCESCGVGGPNLWACLQDGCQSVGCGESYVDH
STLHAQAKKHNLTVNLTTFRVWCYACEKEVFLDPRGPPASQTTSPRLSHRDFPTSAHPLK
SVPIAVGDDGESESDEDDIKPRGLTGMKNIGNSCYMNAALQALSNCPPLTQFFLECGGLV
RTDKKPALCKSYQKLISELWHKKRPSYVVPSSLYHGIKLINPLFRGYSQQDTQEFLRCLM
DQLHEELKEPVPLETQEREEEDRDDQREGERGGTVEEDFLSCDSGGEMGDGEGGGGVGTL
SEMELLIREEVGRGLSEKEKLKERKLSYCHRRTSSEQADEDADVDTAMIPEPDNDAYVHC
SSRSCSPHPVESISKHSSTPPRSSPLRTSHSYVLKKAQVLSGGKKRSEVRYRSVISDIFD
GSILSLVQCLTCDRVSTTIETFQDLSLPIPGKEDLAKLHSTIHQSAVSKAGTCGDSYAAQ
GWLSFFMDYIRRFVVSCIPSWFWGPMITLEDCLAAFFAADELKGDNMYSCERCKKLRNGV
KYCKVLRLPEILCIHLKRFRHEVMYSFKIGSHVSFPLEGLNLRPFLAKECVSRITTYDLL
AVICHHGSASSGHYISYCQNVINGQWYEFDDQYVTEVHETVVQNAEAYVLFYRKSSEEAE
RERQKVVSLAAMKESGLLQFYISREWLNKFNTFAEPGPISNQSFLCSHGGIPPNKYHYID
DLVVILPQSVWEYLYNRFGGGPAVNHLYVCSICQVEIEALAKRRKTEIDTFIKLNKAFQA
EEAPSVIYCISMQWFREWEAFVKAKDSDPPGPIDNSKVALTKSSGQVQLKQGADYGQISE
ETWNYLLNVYGGGPEIAIRQTVAQYQEAEHLHGEQKIEAETRAG
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgggggatgctgaggatttctgccctcaccttgactccattggagaagttaccaaggaa
gatctcatactgaaatccaagggaacatgtgagtcctgtggcgtgggcggacccaaccta
tgggcctgtctgcaggatggctgccagtctgtgggatgtggcgagtcgtatgtggatcat
agcactctgcacgcgcaggcaaagaagcacaacctgactgtcaatctgaccaccttccgt
gtgtggtgctacgcctgtgagaaggaggtatttttggacccccgggggccaccagcctcc
cagacaacatcacccagactcagtcacagggacttccctacttctgctcatccattgaag
tctgtccccattgccgtgggagatgatggagagtcagagagtgatgaagatgacatcaaa
ccaagaggcctcacaggaatgaaaaacattggcaactcctgctacatgaatgcagccctt
caggctctgtccaactgtcctcccctgacgcagttctttctggagtgtggaggcctggtc
cggactgacaagaagccagcactgtgcaaaagttaccagaaacttatctctgagctgtgg
cacaagaaacgcccaagctatgtggtgccctccagcttgtaccatgggatcaaactgatt
aaccctctgttccggggttattcccagcaggacacgcaggagtttctccgctgcctgatg
gaccaactccatgaggaactgaaggaacccgtcccgctagagacccaggaacgggaagag
gaggacagggacgatcagcgagagggagagcgtggcggcacagtggaggaggacttcctg
tcgtgcgattctggtggcgagatgggggacggggagggtggaggaggcgtgggcacattg
tccgagatggagctgctaatccgggaggaagttgggagggggctctctgaaaaggagaag
ttgaaggaaaggaagctgtcatattgtcacagaaggacaagctcagagcaggcagatgag
gatgctgatgtggacacagcaatgattccagagcctgataatgatgcctacgtgcactgc
tcctctcggtcctgcagcccacacccggtggaatccatctccaagcactccagcacccct
cctcgctcaagtccattgcgcaccagtcattcctatgtcctgaaaaaagctcaagtttta
agtggaggaaagaaacgctctgaagtccgataccgcagcgttatctccgatatttttgat
gggtccatactgagtctggtccagtgtctgacctgcgacagggtatccactactattgag
accttccaggacctttccctgcccatccctggaaaggaggacctggccaagttacactcc
accatccaccagagcgctgtctccaaggctggcacttgcggggatagctatgctgcccag
ggctggctgtccttcttcatggactacatacgcagattcgtggtctcttgcatcccaagc
tggttctggggtccgatgataacactagaggattgcctggctgctttctttgctgctgat
gaattaaaaggtgacaacatgtacagttgtgagcgctgtaagaagcttcgaaatggcgtc
aaatactgtaaagtgctgcgtctgccggagattctgtgcattcacctgaaacgtttccgg
catgaagtcatgtactccttcaaaataggcagccacgtctcattccctctggaggggctt
aatctgaggcccttcctggctaaagaatgtgtttctcgcatcaccacttacgacctcttg
gctgttatctgccaccatggcagcgctagcagtgggcactatatatcttactgccagaat
gtgatcaacggacagtggtatgagtttgatgatcagtacgtcacggaggtccatgagacg
gtggttcagaatgcagaggcctatgttctcttctacaggaagagcagcgaggaggcagag
cgggagcggcagaaggtggtgtccttggcagccatgaaagagtccggcctgttgcagttc
tacatctcccgtgagtggcttaacaagttcaacacattcgcagaacctggaccaattagc
aaccaaagtttcctctgttcacatggaggaattccccccaacaaatatcattatattgat
gatctagtggtgattctcccgcagagtgtatgggaatatttatacaacaggtttggagga
ggacccgcagtgaatcacttatatgtctgctcaatctgccaggtggagattgaggctttg
gcgaaacgcagaaagacagaaattgacactttcattaagctcaataaggcattccaagca
gaagaggcccccagtgtaatatactgtattagcatgcagtggtttcgggagtgggaagcc
tttgttaaagccaaggacagtgatcctcccggtcccattgataactccaaagtggcgttg
acaaagagcagcgggcaagtacagctaaaacagggcgctgattatgggcagatttcggag
gagacgtggaattacctgttaaacgtatatgggggtgggccagagatcgccatccgtcag
acagtggcgcagtatcaggaagcagaacatcttcatggagagcagaagattgaagcagag
acacgggctgggtag

DBGET integrated database retrieval system