KEGG   Xenopus tropicalis (western clawed frog): 100036631Help
Entry
100036631         CDS       T01011                                 

Gene name
lamc1, lamb2
Definition
laminin, gamma 1
Orthology
K05635  
laminin, gamma 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100036631 (lamc1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100036631 (lamc1)
Cell adhesion molecules and their ligands [BR:xtr04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      100036631 (lamc1)
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      100036631 (lamc1)
     Laminin-2 Extracellular matrix (ECM) components
      100036631 (lamc1)
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      100036631 (lamc1)
   VLA-3
      100036631 (lamc1)
     Laminin-10 Extracellular matrix (ECM) components
      100036631 (lamc1)
     Laminin-11 Extracellular matrix (ECM) components
      100036631 (lamc1)
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      100036631 (lamc1)
     Laminin-8 Extracellular matrix (ECM) components
      100036631 (lamc1)
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      100036631 (lamc1)
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      100036631 (lamc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 1592 aa AA seqDB search
MRAPVLAVLAVLLLGTVRAAMDECYEEGSPQRCMPEFVNAAFNATVVATNTCGTPPEEYC
VQTGVTGVTKSCHICDSGQFHLQHGAEYLTDYNNQAEITWWQSQTMLAGIQYPSTINLTL
HLGKAFDITYVRLKFHTSRPESFALYKRTHEDGPWIPYQYYSGSCEKTYQKFNRGFIRTG
EDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLN
TFGDEVFSDPKVLKSYYYAISDFAVGGRCKCNGHASECVRNEFEKIVCNCKHNTFGSDCE
KCLPFYNDRPWRRSTADSPNECLPCNCNGRSQECYFDPELYRSTGHGGHCTGCADNTDGP
NCERCRENYYRQDNNEPCHACQCNPVGSLSTQCDNYGRCSCKPGVMGEKCDRCQPGFHSL
TEAGCRPCACNPAGSTDECNVETGRCSCKDNVEGFNCERCKPGFFHLDEANPRGCTPCFC
YGHSSVCSSAEGYRVSSIVSTFESGVEGWTAQQRDGSEYSLSWVSDSSAVSVISESYFPI
YFIAPAKFLGNQGASYGQNLTFSFRVERRDTRLSAEDLVLEGAGLRVSVPLIAQGNSYPS
ETTQRYIFRMHEATDYPWRPSVSPFEFQKMLQNLTAIKIRGSYSERSAGFLEEVSLVTAV
AGAGPSAPWVEICSCPTGYIGQFCERCAPGYRRENPSQGPYSPCVLCTCNGHSDTCDPES
GVCDCQHNTAGPHCERCSEGYYGDSTTGSASDCQPCPCPGGSSCAVVPRTKEVVCTNCPL
GTTGKRCELCDDGYFGDPLGENGAPRPCRICECSNNIDPNAVGNCDRLTGECLKCIYNTG
GFYCDRCRDGFYGNPLAQNPDLKCRACSCNPYGTVKGQSGCNQVTGQCECLPHVTERDCS
ACEPGFYNLLSGRGCERCDCHSLGSTSGQCDVRTGQCECHPGISGQQCQQCEPNHFGFGP
EGCKPCDCDPEGSGSLQCKEDGRCECKSGFVGTRCDQCEENYFYNRSGPGCQECPACYRL
VKDKVNEQRGKLQELEDLLKNLSTGEENITDQAFEERLREAEKAVNDLLLDAQSSKDVDQ
GMLDRLAEINTTLSFQLERLQNIRDMIRDTDKQAQEARDRVENTEFIIDSARVQLEKAKM
AIANVSITPPESTGDPNNMTLLAEEARKLAERHMQEARDIEKAAKEANDTANEALRLLQK
TLASENQTALDIEELNRKYAQAKDIARELEKQASKVHAEAEEAGNRALQIYANLTSVPSI
DTTALQNEADKIQKEAEELDSLIDRKLRDYEDLREDMRGREMEVKNLLDKGKTEQQTADQ
LLARADAAKAQAEEAAKKGRETLQEANDILNKLRDFDKRVNDNKTAAEAALRKIPMIAQT
IAEANNKTRQAESALGNANADARGAKSKAEEAEALANTVQKKAATARAEADNTFKEVTDL
DGELQDMLQQLQEAENQLKKKQAEAESDEKMAEMASNATKDAESNANNSKKSVNGVLATI
DELLSRLGQLDSVDVGQLTVLEKTLDDAKNQLRDSDLDRKLAELQESSNLQRVALDSYSR
DIDQILRDIANLEDIKNTLPAGCYNTPIIEKP
NT seq 4779 nt NT seq  +upstreamnt  +downstreamnt
atgcgggccccggtgctagcggtgttggccgtgctgctactcgggacagtgcgggccgca
atggatgaatgctatgaggaggggagtccccagcgctgcatgcctgagtttgtcaatgcc
gcatttaacgcgactgttgtggccacaaacacatgtggcactcccccggaggagtactgc
gtacagaccggagtcaccggggtaaccaagtcctgccacatctgcgacagcggccagttt
cacctgcaacacggcgccgagtaccttactgactacaacaaccaagcagagattacctgg
tggcagagccagaccatgctggccgggatccagtaccccagcaccatcaacctgaccctg
cacctcggaaaggcctttgacatcacatatgtacgcttgaagttccacacgagtcggcct
gaaagctttgcactgtacaagcgaacacacgaggatggcccatggattccataccagtac
tacagtggctcatgcgagaaaacctaccaaaagttcaatagaggcttcatccgcactggg
gaggatgaacaacaagctctttgtactgatgaatttagcgacatctcgccattaacaggg
ggcaatgtagccttttctaccctcgaaggtcgacccagtgcatacaactttgacaacagt
cctgtattacaggagtgggtgactgctacagatatccgagtgaccctgaatagattaaac
acatttggagatgaagtttttagcgaccccaaagtgctcaagtcttattattatgctatt
tctgactttgctgtcgggggcaggtgcaaatgtaatggccacgccagcgagtgtgtgcgt
aatgagtttgagaagattgtgtgcaactgtaaacacaacacttttggcagtgactgtgag
aaatgcttacccttttataatgaccggccctggaggagatcgactgctgacagtcccaac
gagtgtctaccatgtaattgtaatggacgctcccaggagtgctatttcgatccagaactg
taccgatctacaggacatggtggacattgcactggctgtgcggacaacactgatggccca
aattgtgagagatgccgtgagaactattatcgtcaggacaacaatgagccctgccatgcc
tgccaatgcaacccagttggctctcttagcacccagtgtgacaactatggacgctgcagc
tgcaaacctggtgtgatgggggagaaatgtgatagatgccagcctggctttcactctctt
actgaagctggctgcaggccctgtgcttgtaatcctgccggcagcacagacgagtgcaat
gtagagacgggccgctgtagctgtaaggataatgtggaaggattcaactgtgagaggtgt
aaacctggattcttccacctggatgaggctaacccacgtggctgcactccgtgcttctgc
tatggtcattcctcagtgtgtagcagtgcagagggataccgtgtcagcagcattgtctcc
acatttgagagtggtgtggagggctggacagcacagcagagggatggatctgaatactcg
ctctcctgggtctctgacagcagtgcagtttctgttatttctgagagctactttcccatt
tacttcattgcaccagcaaaatttttgggaaaccaaggtgcaagttatggccagaacctc
acgtttagcttccgggtggagcgccgtgatactcgactttctgcagaggatcttgtgctc
gaaggagctggactcagggtatctgtgcctctcattgcccaagggaactcctacccaagt
gaaactactcaacgctatattttcaggatgcatgaagccactgactatccttggagacca
tcagtatcaccttttgaatttcagaagatgttgcagaatcttacagcaattaagatccga
ggaagctacagcgaacgcagtgctggatttctagaggaggtcagcctggtcactgctgtt
gcaggtgctggtccttctgccccatgggtggagatatgcagctgtcccactggttatatt
ggtcagttctgtgagaggtgcgctcctggctatcgaagagagaacccaagccagggacct
tacagtccttgtgtgctgtgtacttgcaatggtcatagtgacacatgtgaccctgagtct
ggtgtctgtgactgccaacataataccgcaggtcctcactgtgagaggtgcagtgaaggt
tattatggagatagtacaactggtagcgcttcagactgtcagccctgtccatgcccagga
gggtcaagctgtgctgttgtaccaaggacaaaggaggttgtttgtaccaactgccccctg
gggactacaggaaagcgctgtgagctgtgtgatgatggctactttggagacccactgggt
gaaaatggagccccccgaccatgtcgaatttgtgagtgcagcaacaacattgaccccaat
gccgttggtaactgtgaccgtctgactggagagtgcctgaaatgtatctacaacacgggt
ggattttactgtgaccgatgccgagatggcttctatgggaatcctcttgcacaaaaccct
gaccttaaatgcagagcttgcagttgtaacccatatggtactgtcaagggacaaagtggc
tgcaaccaggtgactggtcagtgtgagtgcctgcctcatgtcacagaacgggattgttca
gcttgtgagccaggattctacaacctcttgagtggtcgtggctgtgaaagatgtgattgc
cactccctaggctccaccagtggtcagtgtgatgtccgtacaggacagtgtgaatgccat
cctggcatcagtggccaacaatgccagcagtgtgagccaaaccactttggattcggccca
gaaggctgcaaaccctgtgactgtgatcctgaaggatccggttctctccagtgtaaagag
gatgggcgctgtgagtgtaagagtggatttgtcggcactcgctgtgatcagtgtgaggaa
aattatttctataaccgttctggcccagggtgccaggaatgtccagcttgctaccgattg
gttaaagataaggtgaatgagcagcgagggaagttgcaggaactagaggatctcctaaag
aacttgagtacaggagaagaaaacattacagaccaggcctttgaggaaaggctcagggag
gctgagaaagctgtgaatgaccttctcctggatgcccagagcagcaaagatgtagatcag
ggcatgctggatcggcttgcagagataaacactacactgagcttccagttagaacgtctg
cagaacataagggacatgatccgtgacacagacaagcaggcacaggaggccagagatcga
gtagagaacacagaatttatcattgattctgccagagtacaactggaaaaagccaagatg
gccattgccaatgtgtcaattaccccaccagagtcaactggggatccaaacaatatgacg
ctgcttgcagaagaagcaaggaagctagctgaaagacacatgcaggaagctcgggacatt
gagaaggctgctaaggaggctaatgacactgcaaatgaagcacttcgcttgttacaaaaa
actcttgcttcagagaatcaaacagccttagatattgaagaactaaatcgcaaatacgca
caggctaaggacatagcccgggagctggaaaagcaggctagcaaggtgcatgcagaggct
gaggaggctggaaacagagcactgcagatttatgccaacttgacatcagttcccagtatt
gatactacagcattacagaatgaagcagacaagatccagaaagaggcagaagagctggat
tctttgattgaccgaaagctgcgagactatgaagatctgagagaggacatgaggggtcgg
gaaatggaagtcaaaaatctgctagataaaggaaagactgagcagcagaccgctgaccag
ctacttgcccgagctgacgccgcaaaagcacaagcagaggaggcagcaaagaagggacgt
gaaacacttcaagaagctaatgatatactaaacaagctgagggattttgacaagcgagtg
aatgacaataagacagcagcagaagctgctttacgcaagatcccaatgatcgcccaaacc
attgccgaagccaataacaagacacgacaggcagagagtgcacttggcaatgctaatgct
gacgcacggggggcaaaaagcaaggcagaggaggcagaagctctagccaatactgtacaa
aagaaagcagccacggccagagcagaggctgataacaccttcaaagaagtgacagatttg
gacggggagctccaagatatgctgcaacagctgcaagaagcagagaatcagctaaagaag
aagcaagctgaagcggagagtgatgagaagatggctgaaatggcctctaatgcaacaaaa
gatgctgaatcaaatgccaacaattccaagaagtctgttaatggggttcttgcaacgatc
gatgagttgctctcccgcctcgggcagctagattctgtggatgttggacaactcactgta
ctggagaagacactggacgatgcaaagaaccaactgcgtgacagcgatctggacagaaag
ctagcagaacttcaggagtcttccaacttacagagagttgcactagattcatatagtcga
gacattgaccagatcctgcgagatatagctaatcttgaggacataaagaacaccttgcct
gccggctgctataacacccctattatcgaaaagccttaa

DBGET integrated database retrieval system