KEGG   Xenopus tropicalis (western clawed frog): 100036632Help
Entry
100036632         CDS       T01011                                 

Gene name
pcsk2, nec2, pc2, spc2
Definition
proprotein convertase subtilisin/kexin type 2 (EC:3.4.21.94)
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     100036632 (pcsk2)
Peptidases [BR:xtr01002]
 Serine Peptidases
  Family S8: subtilisin family
   100036632 (pcsk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 639 aa AA seqDB search
MREGVVTVWMLAALVLHLASVLVSAGRPVLTDHFLVDLREGGEAEAKQLAAEYGFSGTRK
LPFTQSLYHFYGNGKTTSRSRRSVNKKKHLAMDPKINKVVQQEGFHRKKRGYRDINDIDI
NMNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGRGVTIAIMDDGIDYLHPDLAS
NYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIR
MLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGG
KGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGR
KRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPGLTWRDLQHLTVLTSKR
NQLHDEVHKWRRNGVGLEFNHLFGYGVLDAGAMVKMANEWKTVPERFHCIGGAIQEPRRI
PSDGKLILTLSTDACEGKENFVRYLEHVQAVITVNSTRRGDLNINMTSPMGTKSILLSRR
PRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEVGFVGSMPEKGVLKEWTLMLHGTQSAPY
IDQIVRDYQSKLAMSKKEELEEELDEAVERSLKSLLSKN
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgagggaaggtgttgtgacagtgtggatgcttgctgctcttgttctgcatcttgccagt
gttctggtctccgctggaagacctgtcctcactgatcattttttggttgacttacgtgaa
ggaggggaagccgaagcgaagcaacttgcagcagaatatggcttcagtgggacaagaaag
ctaccctttacccaaagtttataccatttttatggaaatggaaaaaccacatcgcggagt
cggcgcagtgtcaataaaaagaaacatttagccatggatcccaagataaataaagtggtt
caacaagaaggtttccacaggaaaaaaagaggatacagagacatcaatgatattgacatc
aacatgaacgatccattattcacaaaacagtggtatttgatcaacacaggccaagctgat
gggacacctggactagatctaaatgtagcggaagcatgggaactgggatacacgggaaga
ggggttaccatagcaattatggatgatggaattgattatctgcacccagaccttgcctca
aattacaatgcagaggcaagctatgacttcagcagcaatgatccctacccatatccccga
tatacggatgactggttcaacagccatgggacacgatgtgcaggagaagtgtcagctgca
gccaacaacaatatatgtggcgtcggagtggcttataactctaaagtggcaggcattcga
atgctggaccagcccttcatgactgatatcatagaagcttcatccatcagtcatatgccc
caggttatagacatatacagtgcaagctggggtcctactgacgatggcaaaacagttgat
ggaccaagagaactaactttacaggcaatggcagatggtgtgaacaagggtcgtggtggg
aagggaagtatctatgtgtgggcatctggagatggaggaagttatgatgactgcaactgt
gatggctatgcatcaagcatgtggactatttcaataaactctgctattaatgatggacgc
actgctctgtacgatgaaagttgctcctcaactctggcctctaccttcagcaacggtaga
aaacgaaatcccgaagctggtgtggctacaacagacttgtatggaaactgcactttgcgt
cattcaggaacatctgcagcagcaccagaagcagctggagtatttgcattggccctggag
gctaacccaggtctgacatggagggacctgcagcatctgacagtgctgacttcaaaaagg
aatcagcttcacgatgaagtgcacaaatggcgcagaaatggagttggcttggaattcaat
catttgttcggctatggcgttcttgatgctggagcgatggttaaaatggccaatgagtgg
aaaactgttccagaaaggtttcattgcattgggggagccatacaagagccaaggagaata
ccttctgatgggaagctgatccttaccctttcaactgatgcatgcgaaggaaaggaaaac
tttgtccgatacctagaacacgttcaagcagttataacagtcaattccactcgccgagga
gacttgaacatcaacatgacatcgccaatgggaactaagtctattttattaagtcgtcgt
cctagggatgatgactcaaaggttggttttgataaatggccatttatgacaacacacaca
tggggggaagatccgagaggaacttgggttcttgaagttgggtttgttgggagcatgcca
gagaaaggtgttttaaaagaatggacactgatgttacatggcactcaaagtgccccctat
atagaccaaatagttagagattatcagtctaaattagcaatgtccaagaaagaagagctg
gaggaggaactagatgaagcagtagagagaagtctcaagagcctgttaagcaagaactag

DBGET integrated database retrieval system