KEGG   Xenopus tropicalis (western clawed frog): 100036662Help
Entry
100036662         CDS       T01011                                 

Gene name
paics.2, ade2, airc, paics, pais
Definition
phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase, gene 2 (EC:4.1.1.21)
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:xtr00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 249 aa AA seqDB search
MIPIEWFCRRIASKRNAETEEGYRFPQAKVEMYKVNDTNNHQVSVEQLIAVKLICSGILI
GKIEVDVMTRSTIAIFEIIEKSWRAQDCTLVDMRIKFGVDVTKKEVLLTDIKCGSQALWP
AGNKSQLKNNLCLDGQSRVVVLMASTSDLVHCEEIKKSCSKYGMKCELRVASAHTGPQET
LEIIAEYEGDYIPTVFIAVAGGSNGLGAIVAANSSHPVINCPPLSEDWSTKDIWSSLRVP
SGKKHSVMM
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgattccaatagagtggttctgtcggagaattgccagtaagaggaatgcagagactgaa
gaaggctacagatttccccaagcaaaagtagagatgtataaggtgaatgatactaataat
caccaagtctcggtggaacagttgatagcagtaaagcttatctgttcaggaattctgatt
ggaaagattgaggtggatgtaatgactcgctccacaatagccatatttgaaattatagaa
aaatcatggcgggctcaggactgcactttggtggacatgaggattaagtttggtgttgat
gtgactaaaaaagaagttctacttactgatattaaatgtggctctcaagctctttggcca
gcaggaaacaagagtcagctgaaaaataatttgtgcttagatggccagagcagagttgtc
gtgttaatggcatcaacttcggatcttgtgcactgtgaagaaatcaagaagtcgtgttcc
aagtatggaatgaaatgtgagctgagggtggcttcggcccacacaggcccacaggaaact
ctggagatcatagcagaatatgaaggagattacattccaactgttttcatagcagtggct
ggtggaagcaatggcttaggggctatagtggctgcaaattcttctcatcctgttattaac
tgcccccctcttagcgaagattggagcactaaggatatctggtcttctctcagggtgcca
agtggtaagaaacatagtgttatgatgtaa

DBGET integrated database retrieval system