KEGG   Xenopus tropicalis (western clawed frog): 100036730Help
Entry
100036730         CDS       T01011                                 

Gene name
pnpla6, pnpla7
Definition
patatin-like phospholipase domain containing 6 (EC:3.1.1.5)
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100036730 (pnpla6)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100036730 (pnpla6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 1339 aa AA seqDB search
MGEENGSCNEPALSMGIDLRTRVLQFVEDRLQTTMWTGILIGALVAMAVIGVIGYIVYKK
FRQSKQPHSDVPRYRFRKRDKMMFYGRKIMRKVTTLPNTLVGNAVSRPRTRKKPRVLSLA
KRILRFKKEYPTLQKKEPPPSLLEADLTEFDVKNSHLPSEVLYMLKNVRVLGHFEKPLFL
ELCKHMVFVQLHEGEYIFRPGQLDNSIYVVQDGTLEVCIQESDGADVVVKEVLAGDSVHS
LLSILDVITGHTAPYKTVSARAATASTILRLPANAFQDVFAKYPETLVRVVQIIMVRLQR
VTFLALHNYLGLTTELFNSESQAIPLLSVASLTVGAGGNKAVRRQVSSMSAEEEHGEKCI
EQQPESDQGSLDPSKFSSTDGNGHKRSRSSSSIAEIPGSPKAAKSDMDMAYERARVSLTP
DDMPPSPILNKPILKKSVTVTETPSAVYHYKEEDLVIPEFSVNRHLNAMFEAAKKDLSTL
IKLQDPSLLNGRVTLHQVKGGTILSRQGDQDVNIRFVISGLLHVYQRKIDREEETCLFIT
HPGELVGQLAVLTGEPLIFTIKANRDCTFLSISKCHFYEIMREQPSVVLGVAHTVVKRMS
PFVRQIDFALDWMEVEAGRAVYRQGDKSDCTYIVLNGRLRSVIRKDDGKKQLTGEYGRGD
LIGVVEALTHQPRATTVHAVRDSELAKLPEGALTSIKRKFPQVVTRLIHLLGEKILGSLQ
QVNGPLTGHGLGLHTTGNKWDSSNPASNLSTVAILPVSEEVPLTAFALELRHALGAVGPT
LLLTSDNIKQRLGSAALDSVHEYRLSSWLGQQEDIHRIVLYQSDYCLTPWTQRCIRQADC
ILIVGLGEQEPTVGELEKMLENTAVRAQKQLVLLHKEDGPPPSRTVEWLNMRSWCSGHLH
LSCPHRVFSKRSLPKLIEMYERVSQKPPDRHCDFSRLARVLTGNAIALILGGGGARGCSQ
VGIIKALIESGIPIDLVGGTSIGAFMGALYAEERSFNRMKIRAREWCMDMTSVWKKVLDL
TYPTTSMFSGAAFNKSISSIFKDKQIEDLWIPYFNITTDITASAMRIHTDGCLWRYVRAS
MSLSGYMPPLCDPKDGHLLMDGGYINNLPADVARSLGAKVVLAIDVGSRDETDLTNYGDA
LSGWWLLWKRWNPLADRVKVLNMAEIQTRLAYVCCVRQLEMVKNDDYCEYIRPPIDRYGT
LEFGKFDEICDVGYQHGKTVFNVWGRSGVIDKMLRDRQETCKTKTSDINTCPNASFTDLA
EIVSRIEPVKTAVVDDESDYQTEYEDEEIPDSQKEDYLNFLSAQNNGDVSDSDEEGEMGV
RQRPAAKWRQGMDRSQEYS
NT seq 4020 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaggagaacggcagctgcaatgagccggccctgtccatgggtatagacctgcgc
acccgcgtgctccagttcgtggaagaccgactgcagaccaccatgtggaccggaatcctg
atcggggccctggtcgccatggccgtcattggggtgatcggctacattgtctacaagaag
ttcaggcagtccaagcaaccacattcagacgtgccgcgctatcgcttccggaagagagac
aaaatgatgttttatgggcgcaagatcatgagaaaggtcaccaccctgcccaacactctc
gtgggaaacgcagtctccaggcccagaaccaggaaaaaaccaagagtgctgtctctggct
aaaaggatactccgctttaagaaggaataccccactctgcagaaaaaggagccgccccct
tccctgctggaggcggaccttaccgagtttgacgtgaaaaactcccatttaccctcggaa
gttctgtacatgctgaagaacgtcagggtgctggggcacttcgagaagcccctgttccta
gagctgtgcaagcacatggtcttcgttcagctgcacgagggcgagtacatcttccggccc
ggccaattggacaacagcatttacgtggtgcaagacgggacgttggaagtgtgcatccag
gagagcgacggcgccgacgtggtggtgaaggaggtgttggccggggacagcgtgcacagc
ctgctcagcatccttgatgtcatcaccggacacacagcaccttacaaaacggtttcagcc
agagccgccacagcttccaccatcctgcgactcccggccaatgcctttcaggacgtcttt
gccaaatacccagagaccctagtgagggtggtgcagatcatcatggtccgactccagaga
gtgacgtttctagctctgcataactacctgggtctgactactgagctcttcaactcggag
agccaggccatcccgctgctgtcggtggccagcctgacggtgggggccgggggcaataag
gctgtaaggaggcaggtatccagcatgtcggcggaggaggaacatggagagaaatgtatc
gagcagcagccagagtctgaccagggctccctagacccgagtaaattctcctcaactgat
ggaaatggccacaagcggagccgctcctcctccagcatcgccgaaatcccaggcagtccc
aaggcggctaaatccgacatggacatggcgtacgagcgagcgcgagtgagcctcaccccc
gacgacatgccgccgagccccattctgaacaagcccatcctgaagaagtcggtgactgtc
acggagacgccgtcggccgtttatcactacaaggaggaagatcttgtcattccggaattc
agcgtcaaccgacacctgaacgccatgtttgaggcggccaaaaaggatctgtcgaccctc
atcaaacttcaggacccctctctgctgaatggaagggtgactttacatcaagtcaagggt
ggaaccattttatccagacagggggaccaggacgtgaatattcgcttcgtgatctcgggg
ctcctccacgtttaccagcggaaaatcgaccgggaggaggagacctgcctcttcatcacc
caccccggggagttggtggggcagctggccgttttaacgggggaacccctcatcttcacc
atcaaagccaatcgcgactgcaccttcctctccatctccaagtgccacttctatgagatt
atgagggagcagcccagcgtggtccttggggtggcacacactgtagttaagaggatgtcc
cccttcgtcaggcaaatcgactttgcgttggattggatggaagtggaggcgggacgggct
gtttacagacagggggacaaatcggactgtacctacattgtactgaatgggcgccttcgc
tcggttatcagaaaggatgatgggaaaaagcagctgactggggaatacggacgcggagac
cttatcggggtggtagaagccctgacccaccagccgagggccacaactgtacatgccgtg
cgagactccgagctagccaagttacccgaaggggccctgacctccatcaaacgcaagttc
ccccaggtggtgacccggctcatccatttactcggggagaagattctgggcagcctgcag
caggtgaacggcccccttacagggcacggcctaggtctccacacaaccggcaacaagtgg
gattccagcaacccagccagtaacctttccaccgtcgccatcttgcctgtgtccgaagag
gttcctctgacagccttcgcacttgagctgaggcatgccctgggcgctgtgggccccacc
ctgctgctcaccagcgacaatatcaagcagcgcctgggctccgccgctctggacagtgtc
catgagtacagactgtccagctggttggggcaacaggaggacattcaccgaattgttctg
tatcagtcggattattgcctgacgccatggacccagcgctgtatccggcaggccgactgc
atcctgatagtggggctgggggaacaggagcccaccgtcggagagctggagaagatgttg
gagaacacggccgtccgggcccagaagcaactggttctgctccataaggaagacggaccc
cctccgtcccgcacagtcgagtggctgaacatgagaagctggtgctcggggcacttacac
ctcagctgcccccatcgggttttctccaagaggagcctgcccaagctgatcgagatgtac
gaacgggtttcccagaagcccccggaccgccactgtgacttctcccgactcgctcgcgtg
ctgaccggcaacgccatcgccttaatcttgggaggaggaggagccaggggctgctcccag
gtcggcatcatcaaggcgctcatcgagtcggggatccccatcgacctggtggggggcacg
tccatcggagccttcatgggggccctgtacgccgaggagcgcagcttcaaccgcatgaag
atccgggcgcgggagtggtgcatggacatgacttcagtatggaagaaggttctagatctg
acgtacccgaccacctccatgttttccggtgcggccttcaacaagagcatcagcagcatc
ttcaaggacaaacagatagaggatctatggattccgtattttaacatcaccactgacatc
accgcttcggccatgcgaattcacaccgacggctgcctatggaggtacgtacgtgccagt
atgtccctatcggggtacatgcctccactctgtgaccccaaggatgggcacctcctgatg
gacgggggctacataaacaacctgccagctgacgtcgctcggtcgttaggcgccaaagtg
gttctggctatcgacgtgggcagcagagatgaaacggaccttaccaactatggcgacgcc
ctctccggctggtggctgctgtggaagcgctggaacccgctggccgatcgagtcaaggtc
ctgaacatggcggagatccagacccgactcgcctacgtgtgctgcgtacgccaactggag
atggtcaagaacgacgactactgcgagtacatccgcccccccatcgatcgctacggcacc
ctggaattcggcaagttcgacgagatctgtgatgtggggtaccagcacggcaagaccgtc
ttcaacgtgtgggggcgcagtggggtcatcgacaagatgctgagggaccgacaggagacc
tgcaaaaccaaaacctccgatataaacacctgccccaacgcctctttcaccgacctggcc
gagatcgtgtcccgcatcgaacccgtgaagacagcggtcgtggacgatgagtccgactat
cagacagaatatgaagacgaagagatccccgactcccagaaggaggattatctcaacttc
ctgagcgcccagaacaatggcgatgtctccgacagtgatgaagaaggggaaatgggggtg
agacaacgtcctgcagcaaaatggcggcagggaatggaccgatcccaggagtacagctga

DBGET integrated database retrieval system