KEGG   Xenopus tropicalis (western clawed frog): 100037853Help
Entry
100037853         CDS       T01011                                 

Gene name
bdnf
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100037853 (bdnf)
Cytokines [BR:xtr04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    100037853 (bdnf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 247 aa AA seqDB search
MTILFLTMVISYFSCMKAAPMKEASVRGQSGLAYPGLRTHGTLESIGGLGVSRGGGLPSL
TDTFEHVIEELMEEEQSIRQSEESKDSDLYSSRVMLSSQVPLEPPLLFLLEEYKNYLDAA
NMSMRVRRHSDPARRGELSVCDSISEWVTAANKKTAVDMSGQTVTVLEKVPVSKGQLKQY
FYETKCNPMGYMKEGCRGIDKRYWNSQCRTTQSYVRAFTMDSKKKVGWRFIRIDTSCVCT
LTIKRGR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatacttcagttgcatgaaagctgccccc
atgaaagaagccagtgtcagaggacaaagtggcctggcctatccgggtcttcggacccat
ggtactcttgagagcataggtggtctcggtgtctcaagaggaggaggacttccttcactg
acagatacttttgagcatgtcatagaagaactcatggaagaggaacaaagcatacgacag
agcgaggaaagcaaggactctgacttgtattcatctagagttatgctaagcagtcaagta
cctttggagccaccactgcttttcctacttgaggagtacaaaaactacttggatgctgca
aacatgtccatgagggtccggcgccactcggacccagccaggcgcggagagctgagcgtg
tgtgacagtattagcgaatgggttacagcagcaaacaagaaaactgcagtggacatgtcg
gggcaaacggttactgtcctcgaaaaagtccccgtatccaaaggccaactgaagcaatat
ttctacgagaccaaatgtaaccctatgggttacatgaaagaaggctgcagaggcatagac
aaaaggtactggaactctcagtgccgaactactcagtcttacgtgcgggctttcaccatg
gatagcaaaaaaaaagttggttggcgctttataagaatagacacttcttgtgtatgtaca
ctgaccattaaaaggggaagatag

DBGET integrated database retrieval system