KEGG   Xenopus tropicalis (western clawed frog): 100037861Help
Entry
100037861         CDS       T01011                                 

Gene name
itgb6, xbx6
Definition
integrin, beta 6
Orthology
K06589  
integrin beta 6
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Focal adhesion
ECM-receptor interaction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100037861 (itgb6)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100037861 (itgb6)
  Cellular commiunity
   04510 Focal adhesion
    100037861 (itgb6)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   100037861 (itgb6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 696 aa AA seqDB search
MGIELICLFAFILHGKNHVQGSCALGSTMTCGECLKLGPHCAWCSHKNFTDSLDIAVRCD
TYEVLQSKGCPAESIEFPDSKLEVLRNKPLTEGAQENSSDATQISPQKLLLKLRPGRELT
FQIDVRQTENYPVDLYYLMDLSASMEDDLKTIKELGSSLSKEMSKLTNNFQLGFGSFVEK
PVSPFIKTVPKDIENPCHSIPYYCLPTFGYKHVLSLTPNAQNFNEIVKKQWISGNIDTPE
GGFDAIMQAAVCKEQIGWRNGSLHLLVFVSDGDSHYGMDSKLAGIVIPNDGLCHLDSSNE
YYMSTVQEYPSVGQLIEKLVENNILLIFAVTKAYVPLYQGYASLIPGATVGLLAKDSGNV
LQLIINAYKELRSEIELEVLGDTEGLSLSFTALCNNNTAIPHSKKCQHLKVGDRVSFSVS
ITSASCEKHTRHIVIKPVGLEESLEVEIQSECSCQCHREERSSECSKGNGALECGVCVCY
PPYLGDHCQCNEGSLNSSSCKELDSCGGRGECYCGQCICYPSVYGRIYGSHCECDDFSCL
RHRGVICAGHGDCECGECICHSGWSGSYCNCTMDTQTCISENGALCSGRGECVCGKCVCN
NPEVSGDVCERCPTCGDPCSSKRACVECHLLPAEEQQEECEETCKLVDATVSNAEDFSED
KSISCSLQGENECAITFGMATDEHGKKVIYNIQQKK
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggggattgaattgatctgcctctttgctttcattctgcatggaaaaaatcacgtgcaa
ggaagttgcgctttgggaagtacaatgacttgcggagaatgcctgaaactggggccacac
tgcgcttggtgctctcataagaattttactgactctttggatattgcagttagatgcgat
acctatgaagttcttcagtctaaaggatgccctgctgagtccattgaattcccagattcc
aaattagaggttcttagaaataagccacttacagaaggtgcccaggaaaacagttccgat
gccactcagatcagtcctcagaagcttctcctcaaactaagacccggtagagaactaacg
ttccagatcgacgttcgtcagactgaaaattatcctgtagatctgtactacctgatggat
ctctctgcctctatggaggacgatctgaaaacaattaaggaattgggttcaagcctttca
aaggaaatgtccaagttaacaaacaattttcagttgggatttggatcttttgtagagaaa
cctgtctccccctttattaaaacagttccaaaggatatcgaaaacccttgccatagtatc
ccttattactgcttgccaacctttgggtacaagcatgttctgtccttaacgccgaatgcc
cagaacttcaatgaaatagtgaagaagcagtggatctctggaaatattgacacgccagag
ggagggtttgatgccatcatgcaagcagcagtttgcaaggagcaaattggctggaggaat
gggtctttacatcttctggtgtttgttagcgatggcgactctcactatggtatggacagc
aaactggctggcattgtgatcccaaatgatggcctgtgtcatctagacagcagtaatgaa
tattatatgtctacagtccaggaatatccatcagtcggacagctcattgaaaaactagtg
gaaaacaacattcttctcatttttgcagttacaaaggcatatgttcctttataccagggt
tacgccagtctgattccaggggccacagttggacttctggcaaaggattctgggaatgtc
ctgcagcttattataaatgcatataaagaactgaggtcagagattgagcttgaagtgctc
ggagacacagaaggactcagcctttcctttacagcactgtgtaacaacaacacggctatc
ccacacagcaagaaatgccagcatttaaaggttggggacagagtgtctttcagtgtaagc
attacgtctgcgtcttgtgaaaaacatactcggcacatagtaataaaacccgtgggcctt
gaagagagtctggaagttgagattcagtctgagtgctcatgtcagtgtcacagagaagag
aggagcagtgaatgcagtaagggcaacggagccctggaatgtggggtttgtgtttgctac
cccccttacttgggagaccactgccagtgcaacgaaggctccctcaacagtagctcctgc
aaagaactggactcctgcggtggcagaggggagtgttactgcggccagtgtatctgctat
ccctccgtttacgggcgcatttatgggtcccattgtgaatgtgatgatttctcttgcttg
aggcaccggggagtcatctgtgcaggtcacggggactgtgaatgtggagagtgcatatgc
catagtggctggagcggctcctactgtaactgcacgatggacactcagacctgcatttca
gagaatggcgccctctgcagtggaagaggggaatgtgtctgtgggaaatgtgtttgtaac
aaccctgaagtatctggtgatgtttgtgaaaggtgtcctacgtgtggagatccctgcagc
tcaaaaagggcctgtgtagaatgccatttactgccggcagaagaacaacaagaggaatgt
gaagagacatgcaagctggtggatgccacagtcagcaatgcagaagatttctccgaggat
aaatctatttcgtgctccttgcaaggtgaaaatgaatgtgctattacatttgggatggcg
acggatgagcacggaaagaaagtcatttataacatacagcaaaaaaaataa

DBGET integrated database retrieval system