KEGG   Xenopus tropicalis (western clawed frog): 100037866Help
Entry
100037866         CDS       T01011                                 

Definition
uncharacterized LOC100037866
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100037866
   03008 Ribosome biogenesis in eukaryotes
    100037866
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     100037866
Ribosome biogenesis [BR:xtr03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     100037866
Transfer RNA biogenesis [BR:xtr03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    100037866
Mitochondrial biogenesis [BR:xtr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    100037866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 127 aa AA seqDB search
MAEQKSLPGRGLHTRRPAPRPPRSPSDIYVNTKTDFRAQLARCRQLLGAGGLREVRVHGL
GLAIGRAINLALQLQLSHPGTLLLSPSTSTVELTDDLEPEGGEDMEPGARNRNNSAIHIR
VYRPQGE
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacagaaatcacttcctgggcggggccttcacacacgtcgccccgccccccgg
ccgcctcggagcccaagtgacatttatgtcaatacaaagactgatttccgggcccagttg
gctcggtgccgccagcttctcggtgccgggggcttgagggaagttcgggtgcacggtttg
ggcctggccattgggcgagccattaacctggcgctgcagctgcagttatcccaccccggc
accctgctcctctcccccagcacctccaccgtggaactcaccgacgatctagaacccgag
ggtggggaggacatggaacccggagcccggaaccggaataactctgccattcatatccgc
gtatatcggccacagggagagtga

DBGET integrated database retrieval system