KEGG   Xenopus tropicalis (western clawed frog): 100037866Help
Entry
100037866         CDS       T01011                                 

Definition
uncharacterized LOC100037866
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:xtr03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:xtr03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 127 aa AA seqDB search
MAEQKSLPGRGLHTRRPAPRPPRSPSDIYVNTKTDFRAQLARCRQLLGAGGLREVRVHGL
GLAIGRAINLALQLQLSHPGTLLLSPSTSTVELTDDLEPEGGEDMEPGARNRNNSAIHIR
VYRPQGE
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacagaaatcacttcctgggcggggccttcacacacgtcgccccgccccccgg
ccgcctcggagcccaagtgacatttatgtcaatacaaagactgatttccgggcccagttg
gctcggtgccgccagcttctcggtgccgggggcttgagggaagttcgggtgcacggtttg
ggcctggccattgggcgagccattaacctggcgctgcagctgcagttatcccaccccggc
accctgctcctctcccccagcacctccaccgtggaactcaccgacgatctagaacccgag
ggtggggaggacatggaacccggagcccggaaccggaataactctgccattcatatccgc
gtatatcggccacagggagagtga

DBGET integrated database retrieval system