KEGG   Xenopus tropicalis (western clawed frog): 100037877Help
Entry
100037877         CDS       T01011                                 

Gene name
smug1, xsmug1
Definition
single-strand-selective monofunctional uracil-DNA glycosylase 1
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    100037877 (smug1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     100037877 (smug1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 274 aa AA seqDB search
MEMAGELEKDESILSTHCSGVPSITASAECPANNFLKVELELNLKLSNLVFQDPIQYVYN
PLLYAWAPHEKYVQTYCQSRKEVLFLGMNPGPFGMAQTGVPFGEVNHVRNWLQIEGPVSK
PEVEHPKRRIRGFECPQSEVSGARFWSFFKSLCGQPETFFQHCFVHNHCPLIFMNHSGKN
LTPTDLPKAQRETLLEICDEALCQAVRVLGVKLVIGVGRFSEQRARKALTAEGIDVTVKG
IMHPSPRNPQANKGWEGVVSAQLQELGVLSLLTG
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggagatggcaggggagttagaaaaagatgaatcgattctttctacacattgctctggt
gtaccttccatcactgcttctgctgagtgtccagccaacaatttcctgaaagtggaactt
gagctgaacttgaaactgtctaatctggttttccaggatccaatacagtatgtgtacaat
cctttgttatatgcatgggcccctcatgagaagtacgtgcagacatactgccagtccaga
aaggaagtcttgtttttgggtatgaacccagggccattcggcatggcacagacaggggtt
ccttttggggaggttaatcatgtacgcaactggttgcagattgaagggcctgtatcaaag
ccagaagtggaacatccaaaaaggcgaattcgtggctttgaatgtccccagagtgaagtt
agcggtgcccgattttggagtttctttaagtcgctttgtggacaacctgagacttttttc
cagcactgcttcgtacataaccactgtcctcttatcttcatgaaccattcaggcaagaac
ttgactccgacagaccttcctaaggcacaacgggaaaccttgctggagatatgtgatgaa
gccctttgtcaagctgttagggtacttggagtaaaactggttattggagttgggaggttc
tctgagcaacgtgcaagaaaggccctaacagccgaaggaattgatgttactgtaaaagga
ataatgcatccttctcccaggaacccacaagctaacaaaggctgggaaggagtggttagt
gcccagttgcaggaactcggagtactgtctttactgactggatga

DBGET integrated database retrieval system