KEGG   Xenopus tropicalis (western clawed frog): 100037905Help
Entry
100037905         CDS       T01011                                 

Gene name
arhgef1
Definition
(RefSeq) Rho guanine nucleotide exchange factor 1
  KO
K12330  
Rho guanine nucleotide exchange factor 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Vascular smooth muscle contraction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100037905 (arhgef1)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    100037905 (arhgef1)
Membrane trafficking [BR:xtr04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100037905 (arhgef1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 1063 aa AA seqDB search
MTHSVYLLPSCMSYCGFQKHGSQVSPGLCITYASADLSRGFPLSHSLGFCQTAPKPLVCQ
IRSMDPDDGHFGGLYSKGSMSIIGAEDEDFENDIEPNMVDESSYFRSIELVKEHPAYIMV
FLQHVVLQFDPSPLLCFLHAEMLKNLSAKELKKVFMDFHYTFLMKGAVLHVSVPNSVSFE
LDRTRPEMIPEETQRKYVKDIQKHQTEAISQQLEDFRAKRVLGMTPGELELSELESYRTN
DRSILEAKEKQLAEQLLARLDEMHLTIAPDEEKSSAIFCAIVAYMKHLGVKTKAADSKKS
KGIFFRKKVSTNKKDEPLKTKKTFSILDPMRWNRNDSHYVDSRPSKVEPEAEKPNPDRRV
SQGQRTFDRSDSSTAKSKNSEGPDSVVSVNIIPPPNEPNDPDPAVTDGALSNDASEVLKG
SPTTEHCPADQTEESAENESPEPGGSSEGPLPFLLPQSEETEPRVQEAESDPPNWRELVP
PEILLRLKKSEIKRQEVINELFFTEHAHVRMLRVLHDVFYIPMQNGWIPTLELENIFPSL
DDLIEAHAVFLDTLKRLRLENNSVIQEIGTILLNRFDGTEGNWFQKISSRFCSRQPFALE
QLKAKQKRDPRFTQFIQEAESSPHCRRLQLKDIIPFEMQRLTKYPLLLQNIANLTEEDEE
KQRVQRAAESCRQILNHVNQEVREMENKMKLADYQRRLDVSNLRQINDPLFNEFKNIDIS
KKNLIHEGSLTWKVSRDKAFDVHVLLLDDLLMLLLKQDERLVLKCQSRTIIPAPDGKLML
SPIIKLNMAMVREVATDKNAFFVIFNWEDRAQFYELVAPTPAEKKNWFLLISNTTGLLEP
PASSKQRHRSITPGTMPQSPSDFADQLLSSSENGGSLKDSVSKDEKEESVEDALEGQEEK
DFSGLTEYLLASNIDLNQDAASGGGNVASEALEEVSVLKRLLVRNIRLSVDADTLSTLET
WSAGEEPALEASEQGRASNGDREAEDSEMESTQQGENGRKQSSADVAESLCAPIVLSKEQ
SEEVKRHILSLEQRIQQLKLIEEDYNNLHRTIAKFTVPRSSFT
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atgactcactctgtctacctcttaccctcctgcatgagttattgtggattccaaaagcac
ggctcacaggtttctcctggtctgtgcatcacttatgcatcagccgacctgagcagggga
ttcccattgtctcactcactgggtttttgccagactgctcccaaacccctcgtctgccag
ataagaagcatggatccggacgatggccattttgggggtttgtactccaaggggtccatg
tcgatcattggagcagaggatgaggattttgagaatgacattgaaccgaatatggttgat
gagagcagttacttccgaagcattgagctagtgaaagaacacccggcctacattatggtg
ttcttgcagcacgtggttcttcagtttgaccccagcccactgctctgtttcctgcatgcg
gagatgctaaagaacctttcagccaaagagcttaagaaagtcttcatggattttcactac
acatttctgatgaaaggagcggtactgcatgtcagtgtgccaaacagcgtatcctttgaa
ctggatcggacaaggcctgagatgatcccagaagaaacccagagaaaatatgtcaaagac
attcagaagcaccaaactgaggccatttcccaacagctggaggactttagggccaagcga
gtacttggtatgacccctggggaactggagctgagcgagcttgaatcctatcgaaccaac
gaccgcagtatcctggaagccaaagagaagcagttggcagagcagctcctggcacggctg
gatgagatgcacctaactattgctccagacgaggaaaaaagctctgccatcttttgtgcc
attgtagcctacatgaagcacctgggggtgaagaccaaggcggcggatagcaaaaaatct
aaaggaatcttcttcaggaaaaaggtttctacaaataaaaaggatgagcctctgaaaaca
aagaaaacattcagcatcttggatcctatgcgctggaaccgaaatgattctcactatgtt
gacagcagaccatccaaagttgagcccgaagctgagaagccaaacccggacagaagggtc
agccaggggcagagaacttttgataggagtgacagcagcacagcgaaatccaagaacagc
gaagggcctgattctgtggtgtctgtaaatatcatcccccctcctaatgagcccaatgat
cctgacccagcagtgactgatggggcattgtctaatgatgcatctgaggtcctcaaagga
tcccccaccactgagcattgcccagcagaccagactgaggaaagtgcagaaaatgaaagc
ccagagcctggagggagttcagagggcccgctgccctttctgcttccccagtctgaggag
actgagccgcgcgttcaggaggccgagagcgaccccccaaactggagggagctcgtcccc
cctgaaatactcctcaggctgaagaaaagcgaaatcaagcggcaagaggtcatcaatgag
ctcttctttacagagcacgctcatgtacggatgcttcgtgtgttgcatgatgtcttctac
atccccatgcagaatggatggatccccaccttggagctggagaacatctttcctagcctg
gatgaccttatcgaggctcatgctgtattcctggacaccttgaagcgtctgcgccttgag
aataactcagtgatccaggaaataggcaccatcttgctgaaccggtttgacggcacagag
ggcaactggtttcagaagatttcatctcggttctgcagccggcagccatttgccttggaa
cagttgaaagcgaaacagaagagagaccctcgatttacgcagtttattcaggaagctgag
agcagccctcactgccggcggttacaactaaaggacattataccatttgagatgcaaagg
ctgaccaagtacccgttgctgctgcagaacatcgcaaatctaactgaggaagacgaggag
aagcagagagtgcagagggcagcagagtcttgcaggcagatcctaaaccatgttaaccag
gaggtgcgcgagatggagaataagatgaaacttgcagattaccaaagacgcctggatgtt
tccaacctgaggcaaatcaacgaccccttatttaatgaatttaagaacattgatatcagc
aaaaagaatttgatacatgaaggatctttgacatggaaagtgagcagggacaaggctttt
gatgtccatgtcctcctcctggatgatctcttgatgctgctgctgaaacaagatgagcgg
ctggtactgaagtgccagagtcggactattattcctgctccagacgggaagctcatgctg
agcccaatcatcaagctgaatatggccatggtcagagaggtggctacagataagaatgcc
ttttttgtgattttcaactgggaggatcgagcacagttctatgaacttgtggctccaaca
cccgctgagaagaaaaactggtttttactgatcagcaacactacaggcttattggaaccc
ccagcttcttccaaacagagacacagatctatcactcctggcacaatgccgcagagcccc
tccgactttgcagatcagctgctgagcagctcagaaaatggaggctccctgaaagattca
gtatccaaagatgaaaaggaagagtcggtggaggatgcattggaaggtcaggaagagaag
gacttcagcggccttacagaatacctccttgccagcaacattgatctgaaccaagatgca
gcatctggaggaggcaatgttgccagcgaggccttggaagaagtgtcggtgctaaaacgc
ctgctagtgcgcaatatccgcctcagtgtggatgcagacacgctctcaaccctggagacc
tggtcagcgggggaagaacctgcactggaggcttctgaacagggaagggcctccaatggg
gatcgagaggcagaggattctgaaatggaatctacacaacagggagagaatggcagaaag
cagagttctgcagatgttgcagagtccctgtgcgcacccattgtactgtccaaagaacag
tcggaggaggtgaagaggcacattctgtcactggagcagaggatccagcagcttaagctg
atcgaggaagattacaacaacctgcacagaacaatcgccaaattcactgtaccgaggagc
agctttacatga

DBGET integrated database retrieval system