KEGG   Xenopus tropicalis (western clawed frog): 100037905Help
Entry
100037905         CDS       T01011                                 

Gene name
arhgef1
Definition
Rho guanine nucleotide exchange factor (GEF) 1
Orthology
K12330  
Rho guanine nucleotide exchange factor 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Vascular smooth muscle contraction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100037905 (arhgef1)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    100037905 (arhgef1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 1000 aa AA seqDB search
MDPDDGHFGGLYSKGSMSIIGAEDEDFENDIEPNMVDESSYFRSIELVKEHPAYIMVFLQ
HVVLQFDPSPLLCFLHAEMLKNLSAKELKKVFMDFHYTFLMKGAVLHVSVPNSVSFELDR
TRPEMIPEETQRKYVKDIQKHQTEAISQQLEDFRAKRVLGMTPGELELSELESYRTNDRS
ILEAKEKQLAEQLLARLDEMHLTIAPDEEKSSAIFCAIVAYMKHLGVKTKAADSKKSKGI
FFRKKVSTNKKDEPLKTKKTFSILDPMRWNRNDSHYVDSRPSKVEPEAEKPNPDRRVSQG
QRTFDRSDSSTAKSKNSEGPDSVVSVNIIPPPNEPNDPDPAVTDGALSNDASEVLKGSPT
TEHCPADQTEESAENESPEPGGSSEGPLPFLLPQSEETEPRVQEAESDPPNWRELVPPEI
LLRLKKSEIKRQEVINELFFTEHAHVRMLRVLHDVFYIPMQNGWIPTLELENIFPSLDDL
IEAHAVFLDTLKRLRLENNSVIQEIGTILLNRFDGTEGNWFQKISSRFCSRQPFALEQLK
AKQKRDPRFTQFIQEAESSPHCRRLQLKDIIPFEMQRLTKYPLLLQNIANLTEEDEEKQR
VQRAAESCRQILNHVNQEVREMENKMKLADYQRRLDVSNLRQINDPLFNEFKNIDISKKN
LIHEGSLTWKVSRDKAFDVHVLLLDDLLMLLLKQDERLVLKCQSRTIIPAPDGKLMLSPI
IKLNMAMVREVATDKNAFFVIFNWEDRAQFYELVAPTPAEKKNWFLLISNTTGLLEPPAS
SKQRHRSITPGTMPQSPSDFADQLLSSSENGGSLKDSVSKDEKEESVEDALEGQEEKDFS
GLTEYLLASNIDLNQDAASGGGNVASEALEEVSVLKRLLVRNIRLSVDADTLSTLETWSA
GEEPALEASEQGRASNGDREAEDSEMESTQQGENGRKQSSADVAESLCAPIVLSKEQSEE
VKRHILSLEQRIQQLKLIEEDYNNLHRTIAKFTVPRSSFT
NT seq 3003 nt NT seq  +upstreamnt  +downstreamnt
atggatccggacgatggccattttgggggtttgtactccaaggggtccatgtcgatcatt
ggagcagaggatgaggattttgagaatgacattgaaccgaatatggttgatgagagcagt
tacttccgaagcattgagctagtgaaagaacacccggcctacattatggtgttcttgcag
cacgtggttcttcagtttgaccccagcccactgctctgtttcctgcatgcggagatgcta
aagaacctttcagccaaagagcttaagaaagtcttcatggattttcactacacatttctg
atgaaaggagcggtactgcatgtcagtgtgccaaacagcgtatcctttgaactggatcgg
acaaggcctgagatgatcccagaagaaacccagagaaaatatgtcaaagacattcagaag
caccaaactgaggccatttcccaacagctggaggactttagggccaagcgagtacttggt
atgacccctggggaactggagctgagcgagcttgaatcctatcgaaccaacgaccgcagt
atcctggaagccaaagagaagcagttggcagagcagctcctggcacggctggatgagatg
cacctaactattgctccagacgaggaaaaaagctctgccatcttttgtgccattgtagcc
tacatgaagcacctgggggtgaagaccaaggcggcggatagcaaaaaatctaaaggaatc
ttcttcaggaaaaaggtttctacaaataaaaaggatgagcctctgaaaacaaagaaaaca
ttcagcatcttggatcctatgcgctggaaccgaaatgattctcactatgttgacagcaga
ccatccaaagttgagcccgaagctgagaagccaaacccggacagaagggtcagccagggg
cagagaacttttgataggagtgacagcagcacagcgaaatccaagaacagcgaagggcct
gattctgtggtgtctgtaaatatcatcccccctcctaatgagcccaatgatcctgaccca
gcagtgactgatggggcattgtctaatgatgcatctgaggtcctcaaaggatcccccacc
actgagcattgcccagcagaccagactgaggaaagtgcagaaaatgaaagcccagagcct
ggagggagttcagagggcccgctgccctttctgcttccccagtctgaggagactgagccg
cgcgttcaggaggccgagagcgaccccccaaactggagggagctcgtcccccctgaaata
ctcctcaggctgaagaaaagcgaaatcaagcggcaagaggtcatcaatgagctcttcttt
acagagcacgctcatgtacggatgcttcgtgtgttgcatgatgtcttctacatccccatg
cagaatggatggatccccaccttggagctggagaacatctttcctagcctggatgacctt
atcgaggctcatgctgtattcctggacaccttgaagcgtctgcgccttgagaataactca
gtgatccaggaaataggcaccatcttgctgaaccggtttgacggcacagagggcaactgg
tttcagaagatttcatctcggttctgcagccggcagccatttgccttggaacagttgaaa
gcgaaacagaagagagaccctcgatttacgcagtttattcaggaagctgagagcagccct
cactgccggcggttacaactaaaggacattataccatttgagatgcaaaggctgaccaag
tacccgttgctgctgcagaacatcgcaaatctaactgaggaagacgaggagaagcagaga
gtgcagagggcagcagagtcttgcaggcagatcctaaaccatgttaaccaggaggtgcgc
gagatggagaataagatgaaacttgcagattaccaaagacgcctggatgtttccaacctg
aggcaaatcaacgaccccttatttaatgaatttaagaacattgatatcagcaaaaagaat
ttgatacatgaaggatctttgacatggaaagtgagcagggacaaggcttttgatgtccat
gtcctcctcctggatgatctcttgatgctgctgctgaaacaagatgagcggctggtactg
aagtgccagagtcggactattattcctgctccagacgggaagctcatgctgagcccaatc
atcaagctgaatatggccatggtcagagaggtggctacagataagaatgccttttttgtg
attttcaactgggaggatcgagcacagttctatgaacttgtggctccaacacccgctgag
aagaaaaactggtttttactgatcagcaacactacaggcttattggaacccccagcttct
tccaaacagagacacagatctatcactcctggcacaatgccgcagagcccctccgacttt
gcagatcagctgctgagcagctcagaaaatggaggctccctgaaagattcagtatccaaa
gatgaaaaggaagagtcggtggaggatgcattggaaggtcaggaagagaaggacttcagc
ggccttacagaatacctccttgccagcaacattgatctgaaccaagatgcagcatctgga
ggaggcaatgttgccagcgaggccttggaagaagtgtcggtgctaaaacgcctgctagtg
cgcaatatccgcctcagtgtggatgcagacacgctctcaaccctggagacctggtcagcg
ggggaagaacctgcactggaggcttctgaacagggaagggcctccaatggggatcgagag
gcagaggattctgaaatggaatctacacaacagggagagaatggcagaaagcagagttct
gcagatgttgcagagtccctgtgcgcacccattgtactgtccaaagaacagtcggaggag
gtgaagaggcacattctgtcactggagcagaggatccagcagcttaagctgatcgaggaa
gattacaacaacctgcacagaacaatcgccaaattcactgtaccgaggagcagctttaca
tga

DBGET integrated database retrieval system