KEGG   Xenopus tropicalis (western clawed frog): 100037911Help
Entry
100037911         CDS       T01011                                 

Gene name
cyp1a1, CYP1A, ahh, ahrr, cp11, cyp1, p1-450, p450-c, p450dx
Definition
cytochrome P450, family 1, subfamily A, polypeptide 1 (EC:1.14.14.1)
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:xtr00140]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:xtr00380]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:xtr00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:xtr00980]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 525 aa AA seqDB search
MTSWIGLIADMMDNSTTTEVLVASIVFAIVFLVIRSQRVKLPPGTKKLPGPMPYPVIGNL
LSLSKNPHLSLTKMSETYGDVFQIQIGTKPMLVLSGLETLRQALIRQSDEFAGRPDLFTF
RLVGDGQSMTFSSDSGEVWRARRRLAQNALKTFATSPSPTSSNSCLVEENIITEAEYLIR
KFKELIDDKGEFDPYRYVVVSVANVICGMCFGKRYNHDDEELLNVVNLTDEFGAAAASGN
PADFIPILQYLPNSSMKAFKEINQKFLAFMQKFTKEHYKTFDKNHIRDITDSLIQHSQEK
RVDENSNIQLSNEKIVNIVNDLFGAGFDTITTALSWSLMYLVAHPNIQQRIQDELDQVIG
RERRPRLSDRAQLPYTEAFILEMFRHSSFMPFTIPHCTTKDTMLNGYFIPKGICVLINQW
QVNHDPNLWQDPFKFCPERFLNNDGTMVNKTEMEKVMIFGLGKRRCVGEAIGRMEVFLFL
TTMLQQMQFFKQDGEKLDMSPQYGLTMKHKRCHLTAKLRFALLTN
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgacaagttggataggtttgattgctgacatgatggacaattcaactaccactgaggtt
cttgtggcatctatagtctttgccatagtgttcctggtgattaggtcacaaagggtcaaa
ctcccaccaggaacaaagaaattaccagggcctatgccatatcctgttattgggaatttg
ttatccctgagcaagaatccacatcttagcctgacgaaaatgagcgaaacctatggtgat
gtgttccagattcaaattggcacaaagcctatgctggtccttagtgggctggagactctc
aggcaagcactgatacgacagagtgatgagtttgccggccgtccagatctcttcactttc
cgcttggtcggtgacggtcagagcatgacattcagcagtgattccggagaggtgtggaga
gctcgacgcagacttgcacaaaatgccctcaaaacctttgctacttccccttcacccaca
tcatcaaattcttgccttgttgaagaaaacattattacagaagcagaatatttaataagg
aaatttaaggaactaattgatgacaaaggagagtttgacccctacagatacgtggtggtc
tccgtcgccaatgtcatctgtggcatgtgctttggtaaacgatataaccatgatgatgaa
gagcttctgaatgtggtgaatcttactgatgagtttggtgcagcagctgcttcaggcaac
cctgcagatttcatcccaattctacaatatcttcccaactctagcatgaaggccttcaag
gaaatcaaccaaaagttcctagccttcatgcagaaattcaccaaagagcactacaaaaca
tttgacaagaaccatatacgagatattactgattcacttattcaacactcccaggagaag
agagttgatgagaactcaaatattcaattatcaaatgaaaaaattgtgaatatagtaaat
gacctcttcggtgctgggtttgataccattaccactgctctctcatggagtctcatgtac
cttgtggcccatcctaacatacaacagagaattcaggatgaactggaccaggttattggc
agagaaaggaggcccagattatcagacagagctcagctgccttatactgaagcttttata
ctggagatgttccgtcattcttctttcatgcccttcacgattcctcactgcacaaccaaa
gacacaatgttaaatggatatttcatccccaagggaatctgtgtgctgatcaaccagtgg
caagttaatcatgaccccaacctgtggcaagatccattcaagttctgcccagagcgcttc
ttgaacaacgacggcacaatggtgaacaaaactgagatggagaaagtaatgatttttggc
ttgggaaaaaggaggtgtgttggggaagccattgggagaatggaggtcttcctctttctc
actaccatgctccagcagatgcaattctttaaacaagatggagaaaaactggacatgtct
ccacagtatggactaaccatgaaacacaagcgttgccatcttacagctaaactgcgtttt
gctttgttaactaattaa

DBGET integrated database retrieval system