KEGG   Xenopus tropicalis (western clawed frog): 100037911Help
Entry
100037911         CDS       T01011                                 

Gene name
cyp1a1, CYP1A, ahh, ahrr, cp11, cyp1, p1-450, p450-c, p450dx
Definition
cytochrome P450, family 1, subfamily A, polypeptide 1 (EC:1.14.14.1)
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100037911 (cyp1a1)
  Amino acid metabolism
   00380 Tryptophan metabolism
    100037911 (cyp1a1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100037911 (cyp1a1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100037911 (cyp1a1)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100037911 (cyp1a1)
Cytochrome P450 [BR:xtr00199]
 Cytochrome P450, animal type
  CYP1 family
   100037911 (cyp1a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 525 aa AA seqDB search
MTSWIGLIADMMDNSTTTEVLVASIVFAIVFLVIRSQRVKLPPGTKKLPGPMPYPVIGNL
LSLSKNPHLSLTKMSETYGDVFQIQIGTKPMLVLSGLETLRQALIRQSDEFAGRPDLFTF
RLVGDGQSMTFSSDSGEVWRARRRLAQNALKTFATSPSPTSSNSCLVEENIITEAEYLIR
KFKELIDDKGEFDPYRYVVVSVANVICGMCFGKRYNHDDEELLNVVNLTDEFGAAAASGN
PADFIPILQYLPNSSMKAFKEINQKFLAFMQKFTKEHYKTFDKNHIRDITDSLIQHSQEK
RVDENSNIQLSNEKIVNIVNDLFGAGFDTITTALSWSLMYLVAHPNIQQRIQDELDQVIG
RERRPRLSDRAQLPYTEAFILEMFRHSSFMPFTIPHCTTKDTMLNGYFIPKGICVLINQW
QVNHDPNLWQDPFKFCPERFLNNDGTMVNKTEMEKVMIFGLGKRRCVGEAIGRMEVFLFL
TTMLQQMQFFKQDGEKLDMSPQYGLTMKHKRCHLTAKLRFALLTN
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgacaagttggataggtttgattgctgacatgatggacaattcaactaccactgaggtt
cttgtggcatctatagtctttgccatagtgttcctggtgattaggtcacaaagggtcaaa
ctcccaccaggaacaaagaaattaccagggcctatgccatatcctgttattgggaatttg
ttatccctgagcaagaatccacatcttagcctgacgaaaatgagcgaaacctatggtgat
gtgttccagattcaaattggcacaaagcctatgctggtccttagtgggctggagactctc
aggcaagcactgatacgacagagtgatgagtttgccggccgtccagatctcttcactttc
cgcttggtcggtgacggtcagagcatgacattcagcagtgattccggagaggtgtggaga
gctcgacgcagacttgcacaaaatgccctcaaaacctttgctacttccccttcacccaca
tcatcaaattcttgccttgttgaagaaaacattattacagaagcagaatatttaataagg
aaatttaaggaactaattgatgacaaaggagagtttgacccctacagatacgtggtggtc
tccgtcgccaatgtcatctgtggcatgtgctttggtaaacgatataaccatgatgatgaa
gagcttctgaatgtggtgaatcttactgatgagtttggtgcagcagctgcttcaggcaac
cctgcagatttcatcccaattctacaatatcttcccaactctagcatgaaggccttcaag
gaaatcaaccaaaagttcctagccttcatgcagaaattcaccaaagagcactacaaaaca
tttgacaagaaccatatacgagatattactgattcacttattcaacactcccaggagaag
agagttgatgagaactcaaatattcaattatcaaatgaaaaaattgtgaatatagtaaat
gacctcttcggtgctgggtttgataccattaccactgctctctcatggagtctcatgtac
cttgtggcccatcctaacatacaacagagaattcaggatgaactggaccaggttattggc
agagaaaggaggcccagattatcagacagagctcagctgccttatactgaagcttttata
ctggagatgttccgtcattcttctttcatgcccttcacgattcctcactgcacaaccaaa
gacacaatgttaaatggatatttcatccccaagggaatctgtgtgctgatcaaccagtgg
caagttaatcatgaccccaacctgtggcaagatccattcaagttctgcccagagcgcttc
ttgaacaacgacggcacaatggtgaacaaaactgagatggagaaagtaatgatttttggc
ttgggaaaaaggaggtgtgttggggaagccattgggagaatggaggtcttcctctttctc
actaccatgctccagcagatgcaattctttaaacaagatggagaaaaactggacatgtct
ccacagtatggactaaccatgaaacacaagcgttgccatcttacagctaaactgcgtttt
gctttgttaactaattaa

DBGET integrated database retrieval system