KEGG   Xenopus tropicalis (western clawed frog): 100038053Help
Entry
100038053         CDS       T01011                                 

Gene name
prkacb, XPKAbeta, pkacb
Definition
protein kinase, cAMP-dependent, catalytic, beta
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xtr04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:xtr04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:xtr04340]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:xtr04020]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:xtr04114]
Cellular Processes; Cell growth and death; Apoptosis [PATH:xtr04210]
Cellular Processes; Cell communication; Gap junction [PATH:xtr04540]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:xtr04910]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:xtr04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xtr04914]
Organismal Systems; Endocrine system; Melanogenesis [PATH:xtr04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:xtr04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:xtr04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 351 aa AA seqDB search
MGNAATAKKGNEIESVKEFLAKAKEDFLRKWETPPQNTASLDDFERIKTLGTGSFGRVML
VKHKGAEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKCRGPGDTSNFDDYEEEDIRVSLTEKCAKEFADF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggggaacgctgccaccgcaaagaaggggaatgaaattgagagcgtgaaagaatttcta
gccaaagccaaagaagactttttaagaaagtgggaaactcctcctcagaataccgcaagt
ctagatgattttgagagaataaagacacttggaactggctcatttggaagggttatgtta
gtgaaacataaaggtgcagagcagtattatgctatgaagatactggataaacagaaggtg
gtgaagctgaaacaaatagagcatacactaaatgaaaagaggatattgcaggcagtgaac
tttcctttccttgtcaggttggaatattccttcaaggataactctaatttatatatggtt
atggaatatgtccctgggggagaaatgttttcacatttaagaaggattggcaggttcagt
gagcctcacgcgagattttatgcagctcagatagtgctgacatttgagtacctccattca
ctagaccttatctacagagatctcaaaccagaaaatcttttaattgaccagcaaggatac
attcaggtcacagactttgggtttgctaaaagagtaaaaggcagaacttggacattatgt
ggaacgccagagtatctggcaccagaaattattttgagcaagggttataacaaagcagtt
gactggtgggcattaggagttttaatatatgaaatggctgctgggtatccaccattcttt
gctgatcagcctattcagatctatgaaaaaattgtttcaggaaaggtacggtttccttcc
cacttcagctcagaccttaaagacttgctaaggaacttgctccaggtagatttgaccaaa
cgatatgggaacttgaagaatggtgttaatgacatcaaaaaccacaaatggtttgctaca
acagactggatagcaatttatcagagaaaggtggaagctcccttcataccaaagtgcaga
gggcctggagataccagtaactttgatgactatgaagaagaagatattcgtgtgtctctg
acagaaaaatgtgcaaaagagtttgccgacttttag

DBGET integrated database retrieval system