KEGG   Xenopus tropicalis (western clawed frog): 100038141Help
Entry
100038141         CDS       T01011                                 

Gene name
suv420h1, cgi-85, cgi85, kmt5b
Definition
suppressor of variegation 4-20 homolog 1
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100038141 (suv420h1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100038141 (suv420h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 844 aa AA seqDB search
MKWLGESKNMVVNGRRNGNRLSAEHRQNQPKLHSSGRENLRTSKNVPDRRSGRFANVAFE
TQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTRFRPIKGRQEELKEVIENF
KKSEHLEKTFKNLVAGDWARHYFLNKNKAQEKHFKEHVFIYLRMFATSSGFEILPCNRYS
SERNGAKIVATKEWKRNDKIELLVGCIAELTEAEENMLLRHGENDFSVMYSTRKNCAQLW
LGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEYCECYTC
ERRATGAFKSRVGLNEPGPVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSSNTDADT
SQEKDTSNRKSIGMRKKSKSRSLRRQSVSRIPVSSSSTSSKLPHINNSRVPKRLRKPVKP
LHSKLKIRCHRKKAEQKKASKKLEVSNLVLKEPKVVLYKNLAIKRDRESQGAVQFTETTG
CLTRHAAREYKLNSLKGAHPHGESSPCTYITRSSLRTRFKSKDMSEAKLQPNTVDGYRSS
HGTVTQLDTGEPLCQSTRKNEMLQETSRQSIRFQRNNLNTSRRKCRQNRYIKQASKVEDS
VSIYNSSSKDNALPDLGNSHCDLGEGNFKSSADEYPLVTSEITKTKKNIRTVKNKKSRRI
TRYDAQLILENSTGIPKLTLRRRHDSNSSKTNEKENEGMGSSKISIKLSKDHEKDKNSLY
VAKLNNGFNSGSGSTSTKLKIQLKRDEENRMAFPNENGMYCSDTLSLLGTRMEVDGYDQF
EEESVEESSTEEDGEEEDEFDDEFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSL
RLNA
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggcgaatccaagaacatggtagtgaatggcaggagaaatggaaacaga
ttgtctgctgagcatcgacagaaccagccaaaattgcacagctccggaagagagaattta
agaaccagcaaaaatgttccagacagaagatcaggcaggtttgctaatgtagcttttgaa
acacaaagccgctatgtaccttcatctggaatgtcagccaaggagctgtgtgaaaatgat
gaccttgctaccagtttggtcttggatccctacttaggatttcagacacacaaaatgaat
accagatttcgccctataaaaggacgccaggaagagctaaaggaggtgattgaaaacttt
aagaaaagtgaacatcttgaaaaaacctttaaaaatttagtagcaggcgactgggctcgg
cactatttcctcaacaagaacaaagcgcaagaaaagcatttcaaggagcatgtttttatc
tacttgagaatgtttgcaactagcagtgggtttgaaatcctgccttgcaatagatactcc
tcagagcgaaatggagccaaaatagttgcaacaaaagaatggaaacggaatgataaaatt
gagcttcttgtgggctgcattgcagaattaactgaagcagaggaaaatatgcttctacgg
catggggaaaatgactttagcgtcatgtattccacaaggaaaaactgtgctcaactgtgg
ctagggcccgctgcctttattaaccatgattgccggcctaactgtaagtttgtatccact
ggccgtgacaccgcatgtgtaaaagctctccgagatattgagcctggagaagagatttcc
tgttattatggggatggcttttttggagaaaacaatgaatattgtgaatgctacacatgc
gaaaggcgtgcaactggtgcttttaaatcacgtgttggacttaatgaaccaggccctgtg
ataaacagcaaatatggacttcgagaaacagacaaacgcttaaatcgtctaaaaaaactt
ggagatagcagcaaaaactccgacagccagtcagtcagctctaatactgatgcagacaca
tctcaggaaaaagacacttcaaatagaaaatctattggaatgagaaagaaaagtaaaagc
agatcactgaggagacagtcagtgtcaagaattccagtttcatcatcttctacctcatcc
aagcttcctcacattaataattccagggtaccaaagagactaagaaagcctgtaaagcct
ttacattcaaaattaaagataagatgtcatcgcaaaaaagctgagcagaagaaagcctct
aagaagcttgaagtttcgaacttggttcttaaagaacctaaagttgtgctgtataaaaac
ttggcaatcaagagggatagagaaagtcagggtgcagttcaatttacggaaactactggt
tgtttgacgagacacgctgcaagagaatataaactaaattccttaaaaggtgctcatcca
catggtgaatcttcaccatgtacttatatcactcggagttccttgagaactagatttaaa
tccaaggatatgtcagaggccaagcttcaaccaaatacagtcgatggttatagaagcagc
catggaactgttacacagttagatacaggtgaaccactttgtcagtcaactcgtaaaaat
gaaatgcttcaagaaacctcaagacaaagtatcagatttcagaggaataacttaaacaca
tctagaagaaagtgtcgacaaaatagatatatcaagcaagcttcaaaagttgaagattca
gtatctatttataattcatccagcaaagacaatgcattaccagacttaggaaattcacat
tgtgatttaggtgaaggaaatttcaaaagctctgcagatgaataccctctagtgacttct
gaaattactaagacaaaaaaaaatattcggacagtgaaaaataaaaaaagcagacgaata
accagatatgatgcacaattgattcttgaaaacagcactggaattccaaagctaaccctt
cgaaggcgacatgacagtaacagtagcaagaccaatgaaaaggagaatgaagggatgggt
tcatcaaaaataagcattaaattaagcaaggatcacgaaaaggacaagaacagtttgtat
gttgcaaagctcaacaatggttttaactcaggatcagggagcacttcaacaaagttgaag
atacagttaaagcgggatgaggagaataggatggcttttcctaatgagaatggcatgtat
tgtagtgatacattatctctgttgggaacaagaatggaagttgatggttatgatcagttt
gaggaggaaagtgttgaagaatcctccacagaagaagatggagaggaggaagatgagttt
gatgatgaatttgaagatgattttatccccctccctccagcaaaacgtttgagacttatt
gttggaaaggactcgatagacattgatatatcttccagaaggagagaagatcaatccttg
agactcaatgcataa

DBGET integrated database retrieval system