KEGG   Xenopus tropicalis (western clawed frog): 100038163Help
Entry
100038163         CDS       T01011                                 

Gene name
clock, XClock, Xclk, clk
Definition
clock circadian regulator (EC:2.3.1.48)
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Herpes simplex infection
Class
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:xtr05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 829 aa AA seqDB search
MSSTADRDDGSIFDGLVEEDDKDKAKRVSRNKSEKRRRDQFNILIKELGSMLPGNARRMD
KSTVLQKSIDFLRKHKEISAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAVMTDG
NIIYVSESVTSLLEHLPSDLVDQSIFNFVPEGEHSEVYKILSTRMLESGSLSSEYLKTKN
ELEFCCHMLRGTADPKEPSTYEFVKFIGNFKSLNNVPSSTHNGFDGALQRSLRPPYEERV
CFVATVRLATPQFIKEMCTVEESTEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSG
YDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTRYYITYHQWNSRPEFI
VCTHTVVSYAEVGAERRRERGIEDSPPAITADKNQDSVSDNHMNTVSLKEALERFDDSRT
PSPSSKSSIKSSSHTAVSDPSSTPTKITTETSTPPRQAITGLDKRRSSVSSQSMSSQSVS
QALSQSVMKQTASMQLQQGMAQPMFQFTAQFGAMKHLKDQLEQRTRIIEENIQRQQEELR
KIQEQLHMVHGQGIQMFLQQPGPGLNFGPVQVSSANSASIQQLPQLTMQGQVVQTNQLQA
GMNTGHVGAQHIMQQQQLQTTSQQGQQNIHGGHSQQTSLSSQTSGTLTSPLYNTMVISQP
PSGSMVQMPSNIQQSNQGASVTTFPQDRQIRFSQAQQIVTKLVTTPVACGTVMVPSTMFM
GPVVTAYPTFATQQQQQQQQPQTLSITQHQPNQQDQQSMPTVQQPAQAQLAQQPQQFLQT
SRLVHGNQSTQLILSPFPVQQNTFAPSHQQQLSHHRTDSMSDPSKVQQQ
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atgagctccactgcagacagagatgacggtagtatttttgatggacttgtggaagaagat
gacaaggataaagcaaagagggtgtctcggaacaaatcggagaaaaggagaagagatcag
ttcaatattctcattaaggagcttggctctatgttgccaggcaatgcccgaaggatggac
aaatccactgtgctgcagaaaagcattgacttcctacggaagcataaagaaattagtgca
cagtcggatgctagtgaaatacgacaagactggaaacctacgttccttagtaatgaggaa
tttactcaactcatgctggaggcactggatggatttttcctggcagttatgacagatgga
aacataatatatgtatctgaaagtgtgacttccttacttgaacacttaccgtctgatctt
gttgatcagagtatatttaattttgtccccgagggggaacattcagaagtgtataaaatt
ctatctacgcggatgttggaaagtggttctttgtcatcagagtatcttaaaacaaaaaat
gaacttgaattctgttgccacatgttaagaggcacagctgaccccaaagagccatcaacc
tacgaatttgtaaagtttattggaaatttcaagtccttaaataacgtgcccagctctaca
cataatggttttgatggtgcattacagaggtcactgcggccgccctatgaagagagagtg
tgctttgtagctactgtaaggctagctacgccacagttcattaaggaaatgtgtactgta
gaggaatccactgaagagttcacatcaaggcacagtctggaatggaagtttcttttcttg
gaccacagggcccctccaataattggatatttgccttttgaagtgctggggacttccggc
tatgattactatcatgtggatgacctggaaaaccttgcaaaatgccatgaacacttaatg
cagtatgggaaaggcaagtcatgctattataggttcctgacaaaagggcaacagtggata
tggctgcagacacgctattatatcacctaccatcagtggaattccaggccagagtttata
gtttgtacgcatactgtagtaagctatgctgaggttggggcagaaagaagacgtgagcgg
ggcattgaagattcccctcctgccataactgcagataaaaatcaggactctgtctcagac
aatcacatgaacacagttagcctgaaggaagctttggaaagatttgatgacagccgaaca
ccctcaccatcatccaaaagctcaattaaatcatcatctcacactgctgtgtcggaccca
tcatcaacaccaacaaagatcacaacagaaacaagcacacctcccagacaagctataact
ggccttgacaagaggaggtcgtcagtcagcagccagtctatgagttctcagtcagtcagc
caggcgctgtcacagtcagtgatgaaacaaacagcatctatgcagctccagcaaggaatg
gcacagcccatgtttcagttcacggctcagtttggagctatgaagcatctgaaggaccag
ctggagcagagaactcggatcattgaagaaaatatccaacggcaacaggaggagctgcgt
aagattcaagagcagctgcatatggtccatgggcagggaatccagatgttcttacaacaa
ccaggaccagggctaaattttgggccagtgcaagtctcttctgcaaacagtgcaagcatt
cagcagttaccacagctcaccatgcaaggccaggtggtccaaactaatcaacttcaagct
ggcatgaacactgggcatgtgggagctcagcacataatgcagcagcaacagttacagact
acaagccagcaaggccagcagaatattcatggagggcacagccagcagacttctctgtct
agccagacgtctggaacactcactagtcctttgtacaacactatggtgatctcccagcca
ccttctggtagtatggtacagatgccttccaacatacagcagagcaaccagggagcctct
gtcactacatttcctcaggacaggcagattaggttttctcaagctcaacaaattgttact
aagctggtgaccactcctgtggcttgtgggacagttatggtcccaagcacaatgtttatg
ggcccagtggttactgcctaccctacatttgctacacagcaacagcagcagcagcagcaa
ccccagaccttatcaataacccagcaccaaccaaatcagcaagaccagcagtcaatgcct
acagtacagcagcctgctcaagcgcaattagcccagcagccacagcagtttttgcagacc
tctaggttggtccatggaaaccagtccacacagctcatcctttcccctttccctgtgcaa
cagaacacttttgccccatcacaccagcagcagttatcccatcataggactgacagtatg
agtgatccttccaaggtgcagcaacagtag

DBGET integrated database retrieval system