KEGG   Xenopus tropicalis (western clawed frog): 100038163Help
Entry
100038163         CDS       T01011                                 

Gene name
clock, XClock, Xclk, clk
Definition
clock circadian regulator (EC:2.3.1.48)
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100038163 (clock)
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100038163 (clock)
Transcription factors [BR:xtr03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100038163 (clock)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 829 aa AA seqDB search
MSSTADRDDGSIFDGLVEEDDKDKAKRVSRNKSEKRRRDQFNILIKELGSMLPGNARRMD
KSTVLQKSIDFLRKHKEISAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAVMTDG
NIIYVSESVTSLLEHLPSDLVDQSIFNFVPEGEHSEVYKILSTRMLESGSLSSEYLKTKN
ELEFCCHMLRGTADPKEPSTYEFVKFIGNFKSLNNVPSSTHNGFDGALQRSLRPPYEERV
CFVATVRLATPQFIKEMCTVEESTEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSG
YDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTRYYITYHQWNSRPEFI
VCTHTVVSYAEVGAERRRERGIEDSPPAITADKNQDSVSDNHMNTVSLKEALERFDDSRT
PSPSSKSSIKSSSHTAVSDPSSTPTKITTETSTPPRQAITGLDKRRSSVSSQSMSSQSVS
QALSQSVMKQTASMQLQQGMAQPMFQFTAQFGAMKHLKDQLEQRTRIIEENIQRQQEELR
KIQEQLHMVHGQGIQMFLQQPGPGLNFGPVQVSSANSASIQQLPQLTMQGQVVQTNQLQA
GMNTGHVGAQHIMQQQQLQTTSQQGQQNIHGGHSQQTSLSSQTSGTLTSPLYNTMVISQP
PSGSMVQMPSNIQQSNQGASVTTFPQDRQIRFSQAQQIVTKLVTTPVACGTVMVPSTMFM
GPVVTAYPTFATQQQQQQQQPQTLSITQHQPNQQDQQSMPTVQQPAQAQLAQQPQQFLQT
SRLVHGNQSTQLILSPFPVQQNTFAPSHQQQLSHHRTDSMSDPSKVQQQ
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atgagctccactgcagacagagatgacggtagtatttttgatggacttgtggaagaagat
gacaaggataaagcaaagagggtgtctcggaacaaatcggagaaaaggagaagagatcag
ttcaatattctcattaaggagcttggctctatgttgccaggcaatgcccgaaggatggac
aaatccactgtgctgcagaaaagcattgacttcctacggaagcataaagaaattagtgca
cagtcggatgctagtgaaatacgacaagactggaaacctacgttccttagtaatgaggaa
tttactcaactcatgctggaggcactggatggatttttcctggcagttatgacagatgga
aacataatatatgtatctgaaagtgtgacttccttacttgaacacttaccgtctgatctt
gttgatcagagtatatttaattttgtccccgagggggaacattcagaagtgtataaaatt
ctatctacgcggatgttggaaagtggttctttgtcatcagagtatcttaaaacaaaaaat
gaacttgaattctgttgccacatgttaagaggcacagctgaccccaaagagccatcaacc
tacgaatttgtaaagtttattggaaatttcaagtccttaaataacgtgcccagctctaca
cataatggttttgatggtgcattacagaggtcactgcggccgccctatgaagagagagtg
tgctttgtagctactgtaaggctagctacgccacagttcattaaggaaatgtgtactgta
gaggaatccactgaagagttcacatcaaggcacagtctggaatggaagtttcttttcttg
gaccacagggcccctccaataattggatatttgccttttgaagtgctggggacttccggc
tatgattactatcatgtggatgacctggaaaaccttgcaaaatgccatgaacacttaatg
cagtatgggaaaggcaagtcatgctattataggttcctgacaaaagggcaacagtggata
tggctgcagacacgctattatatcacctaccatcagtggaattccaggccagagtttata
gtttgtacgcatactgtagtaagctatgctgaggttggggcagaaagaagacgtgagcgg
ggcattgaagattcccctcctgccataactgcagataaaaatcaggactctgtctcagac
aatcacatgaacacagttagcctgaaggaagctttggaaagatttgatgacagccgaaca
ccctcaccatcatccaaaagctcaattaaatcatcatctcacactgctgtgtcggaccca
tcatcaacaccaacaaagatcacaacagaaacaagcacacctcccagacaagctataact
ggccttgacaagaggaggtcgtcagtcagcagccagtctatgagttctcagtcagtcagc
caggcgctgtcacagtcagtgatgaaacaaacagcatctatgcagctccagcaaggaatg
gcacagcccatgtttcagttcacggctcagtttggagctatgaagcatctgaaggaccag
ctggagcagagaactcggatcattgaagaaaatatccaacggcaacaggaggagctgcgt
aagattcaagagcagctgcatatggtccatgggcagggaatccagatgttcttacaacaa
ccaggaccagggctaaattttgggccagtgcaagtctcttctgcaaacagtgcaagcatt
cagcagttaccacagctcaccatgcaaggccaggtggtccaaactaatcaacttcaagct
ggcatgaacactgggcatgtgggagctcagcacataatgcagcagcaacagttacagact
acaagccagcaaggccagcagaatattcatggagggcacagccagcagacttctctgtct
agccagacgtctggaacactcactagtcctttgtacaacactatggtgatctcccagcca
ccttctggtagtatggtacagatgccttccaacatacagcagagcaaccagggagcctct
gtcactacatttcctcaggacaggcagattaggttttctcaagctcaacaaattgttact
aagctggtgaccactcctgtggcttgtgggacagttatggtcccaagcacaatgtttatg
ggcccagtggttactgcctaccctacatttgctacacagcaacagcagcagcagcagcaa
ccccagaccttatcaataacccagcaccaaccaaatcagcaagaccagcagtcaatgcct
acagtacagcagcctgctcaagcgcaattagcccagcagccacagcagtttttgcagacc
tctaggttggtccatggaaaccagtccacacagctcatcctttcccctttccctgtgcaa
cagaacacttttgccccatcacaccagcagcagttatcccatcataggactgacagtatg
agtgatccttccaaggtgcagcaacagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system