KEGG   Xenopus tropicalis (western clawed frog): 100038285Help
Entry
100038285         CDS       T01011                                 

Gene name
gk, gk1, gk2, gkd, gyk
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:xtr00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:xtr03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 556 aa AA seqDB search
MAASNRVILGPLVGAIDQGTSSTRFLVFNAKTAELLSHHQVEIKQKFPKEGWVEQDPKEI
LQSVYECVEKTCEKLTQLNIDITNIKAIGVSNQRETTVVWDKTTGEPLYNAVVWLDLRTQ
STVERLLKRIPGKNKNFFKSRTGLPLSTYFSAVKIRWLLDNVEEIRHAVSEGRAMFGTVD
SWIIWSLTGAKNGGVHCTDVTNASRTMLFNIHTLEWDTELCQFFDIPMELLPKVRSSSEI
YGLMKSGALTGVPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGSKPVLSEHG
LLTTVAYKLGRDKPACYALEGSVAIAGAVVRWLRDNLGIVKTTEEVEKLAAEVGTSYGCY
FVPAFSGLYAPYWEPSARGIICGLTQFTNRNHIAFAALEAVCFQTREILDAMNKDCGIPL
NQLQVDGGMTSNKILMQLQADILCIPVVKPSMPETTALGAAMAAGAAEGVGVWSLNPGDL
TAVTCERFEPQINPEESEFRYARWKKAVMKSMGWESAEPTNGNGDCSIFCSLPLGFYIVS
SMVLLIGAKYISGLNK
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgtccaacagagtcattctgggacctctggtgggagcaattgaccaaggcacg
agttcaacacgctttctggtttttaatgcaaaaacagcagaacttctgagccaccatcaa
gtagaaatcaaacaaaagtttccaaaagaaggatgggtagagcaagatccaaaggaaatt
ttacagtctgtttacgaatgtgtagagaagacttgtgagaagctgacccagctaaacatt
gacatcacaaatattaaagcaattggagtcagtaaccaaagggaaacaactgtcgtgtgg
gacaagacaacaggagagcctctgtacaatgctgttgtttggcttgatttgagaacacaa
tcaactgtagagcgacttttgaagagaattcctggcaaaaataagaattttttcaagagt
cggactggtcttccacttagtacttacttcagtgcagtaaaaattagatggcttctagac
aatgtggaagagattagacatgcagtttcagagggaagagcaatgtttggtacagtagat
tcctggatcatttggagcctgactggtgcaaagaatggaggtgtgcattgtacagatgtg
accaatgccagcaggacaatgctgttcaatattcacacattggaatgggacacagagctc
tgccagtttttcgatatacctatggaattattgccaaaagtcagaagttcatcggagatc
tatggtctcatgaagtctggggctttgactggagttccaatatctgggtgtttaggagac
cagtcggctgctttagttggacaaatgtgttttcaagatggacaagctaaaaatacatac
ggtaccggctgctttttgttatgcaacacaggctcaaagcctgtcctctcagaacacggc
ctcttgacaactgttgcctacaagctaggacgggacaagcctgcatgttatgccctggag
ggatcagttgccatagcaggagctgtggtgcgctggttgagagacaatcttggaatagta
aagactactgaggaagtagaaaagcttgctgctgaagtcgggacatcatatggctgctac
tttgttcctgcattttcaggtttatacgctccctattgggagccaagtgccagaggtatc
atctgtggtctcacccagtttacaaacagaaaccatattgcatttgctgctcttgaggct
gtgtgtttccagactagagagattctggatgctatgaacaaagattgtggtattcctctc
aatcaacttcaagttgatgggggcatgacaagcaataaaatcctcatgcagttgcaggct
gatatcctgtgcattccagtagtaaaaccatccatgcctgaaacaactgcactgggcgct
gctatggctgcaggtgcagctgaaggtgtcggtgtttggagcttaaatcctggagattta
actgctgtaacatgtgaacggtttgaaccacaaatcaacccagaggaaagtgaatttcgc
tatgcaagatggaaaaaggcagtgatgaaatcaatgggctgggaatctgcagagcctacc
aatggaaatggtgactgtagtatcttctgtagtcttcctctggggttttatatagtgagt
agcatggtattattaatcggagcaaagtacatctcaggtcttaataaataa

DBGET integrated database retrieval system