KEGG   Xenopus tropicalis (western clawed frog): 100101677Help
Entry
100101677         CDS       T01011                                 

Gene name
crebbp, cbp, kat3a, p300, rsts
Definition
CREB binding protein (EC:2.3.1.48)
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:xtr04310]
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:xtr04330]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:xtr04350]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:xtr04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xtr04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:xtr04110]
Cellular Processes; Cell communication; Adherens junction [PATH:xtr04520]
Organismal Systems; Endocrine system; Melanogenesis [PATH:xtr04916]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:xtr05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 2427 aa AA seqDB search
MAENLLDGPPNRKRPKLSSPGFSASTDSTDFVSFFDLENDLPDELIPNGGELSILGTGGN
LGQDAASQNKQLSDLLRGGNAGLGTAMGRGGSGSPVQQGMGSQGQQNSPGLGNLSSLNKS
PLNQGLSVTPPSGLTKTTTGTPGPSVPASQAQKQVSMVAGSPAAPQAPTGICMNSNFNQG
HQALLNSNSGHTLMSQAQPAQGQVLNGSLGVGNRGRGAALQYNSPAMQTNPGSVLAETLT
QGATTMPTHAGMTTAQTGAMTKMGLPGNTSPFGQTFNQATGQQIRAQGVSPQLPAKPAMA
NSLPPFPSDIKNTPVANVPNMAQVQQVGIGTTPSMGTGPTADPEKRKLIQQQLVLLLHAH
KCQRREQNNGEMRDCSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRH
DCPVCLPLKNASDKRNQNLPVSLSSGVQNPIGTAGAGQQSAPSLSSPNPIDPSSMQRAYA
ALGLPYGNQAQSTGQQPAQTQVHQQIRNMNSLGGNQISLTAGGMAVEQQTNLISEASLPT
ALASSNSLLNDGNSQSTVGNLGTMPTAAPPSTTGVRKAWHEHVTQDLRNHLVHKLVQAIF
PTPDPAALKDRRMENLVAYARKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRL
QKQGIMSNQPPLQAPGTQPPTLTQTAAALGQTQPVRPTNGPISMSMNRMQVASGMNQFSS
MPIGNVQMPTAPMGPRAASPLNHPTQMNNMGSVPAMAMSPSRMSQPQSIIGAHAGSLMGP
TQTQNQFLQQNQFPASTGTISVGLGQTGAAAAVSQQGQAPTASLPISNSLNMLGPQTSQL
PRPALSQSPLHQTPPSVTASAAVMPSVQHQAPTGLTPPKPTAPAQPSTPLPTPGQTPAPT
PGSVPNSMQSQSTPTVQAAAQAQLTPQPPTPVPIQSVPTPQPAQLQPTSVHAPAPGTPLS
QAAASVDNHVRTPASVASTDNQPAPDHSMTEVKVEGKTDEPEACENQVEPKTEVEPDASS
QVKEPVCESTEIKSEPMEVEEKKTEIKTENKEEEENGGTNSSLQSTSPSQPRKKIFKPEE
LRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQE
PWQYVDDVWLMFNNAWLYNRKTSRVYKYCTKLAEVFEQEIDPVMQSLGYCCGRKFEFSPQ
TLCCYGKQLCTIPRDAAYFSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKEQFEK
KKNDMLDPEPFVDCKECGRKMHQICVLHFDIIWPSGFVCDNCLKKTGRTRKENKFCAKRL
QTTRLGNHLEDRVNKFLRRQNHPEAGEVSVRVVASSDKIVEVRPGMKSKFVDTGEMPESF
PYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPMPNTRRVYISYLDSIHFFRPRSLRTAV
YHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDK
AFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEENT
AACETTEGCQGDSKNAKKKNNKKTNKNKSSMSRANKKKASMPNVCNDLSQKLYATMEKHK
EVFFVIHFYAGPVINSLPPIADPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTL
CMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCVNCYNAKSHEHKMVKWGLGL
DDESNSQGEAQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCK
RKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQIQHRLQQAQLMRRRM
ATMNTRAVPQQSLPSPTSATPGTPTQQPSTPQTPQPAPQPSPVSIASPGFPSVQRTQPPN
VASQGKPTNPVPPVPPSQPTVQPPPAAVAAARQIELEAQQQQLYRVTSIAEGINSARPGM
VNPSVGSVNPMQQMAMNVPRPGPIGAPPIMAGMQPGQWPAAQLPQQPQMQQSIQRPVMQM
ATAQQAVAGPRLAGVPPQQARNIAPAPNALQDLLRTLKSPSSPQQQQQVLNILKSNPHLM
AAFIKQRTAKYVANQPGMQPQQAPQQQQQPQQPGMHPQAGLQNMSPMPVGVPRAAVPQQQ
PGMAPQGQGIGLMNTAHNTNLANINPQYREMYRRQQLLQQQQQQQQQQQQSAAGMAGGLP
AHGQFQQPQGAYPQPQALQQQRMQQHLSIQGGTMGQIPQMAQPGLGNEGSQASLQQALHQ
RIQQQIKQQIASGQANPMSPQQHLLTGQPPSAHLPTGQQIATALSNQVRSPAPVQSPRPQ
SQPPHSSPSPRVQPQPSPHHVSPQTGSPHPGLAASMGNSLDQGHLGNPEQSAMLPQLNPP
NRSALTNDLSLVGDTSGDTLEKFVEGL
NT seq 7284 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaacctgctggacgggccacccaacaggaagagacccaaactgagctcgcca
ggcttctctgccagcactgacagcacagactttgtatccttctttgacttggaaaatgat
cttcctgatgagctaattcccaatggaggagaactaagcattttgggtactggcggaaac
ctggggcaagatgcagcttcccaaaataagcaactgtccgatctcctacgtggtggaaat
gcagggcttggaacagctatgggcagaggaggttctggcagtccagtgcaacagggaatg
ggatcccaggggcagcaaaatagccctggacttggaaatcttagcagtctcaacaagagc
ccactcaatcagggcctatctgttactccaccctcgggacttaccaagacaacaactggt
acacctggtccttcggttcctgcctctcaagcacaaaagcaagtcagtatggtggcgggc
agtccggccgctccacaggcacctacaggaatctgcatgaactcaaactttaatcaaggg
catcaggcactgctaaatagtaactctgggcacacactaatgagccaggcccagccagca
cagggacaggtccttaatgggtctttaggcgttggaaacagaggtcgaggggctgctctt
cagtacaactcacctgccatgcaaactaatccaggaagtgtcctggcagaaacattaaca
caaggagcaacaactatgccaacacatgcaggaatgacaactgcccagactggagccatg
actaagatgggacttccaggcaacactagtccttttgggcagacatttaaccaagctaca
ggtcagcaaatccgagcccagggggtcagccctcagctgcctgcaaagcctgccatggca
aacagccttcctcctttcccctctgacatcaaaaatacccctgttgctaatgtacccaat
atggctcaggtgcagcaagttggtattggcacaacgccgtccatgggaactggcccaaca
gctgacccagagaagcgcaagcttatacagcaacaacttgtcctactgcttcatgcacac
aagtgtcagcggcgagagcagaataatggcgaaatgagggactgctccctgcctcattgt
cgcaccatgaagaacgtgcttaaccacatgacccattgccaggccgggaaggcctgccaa
gttgcccactgtgcttcctcaagacaaatcatctctcactggaaaaactgtacgcggcat
gactgtcctgtgtgcctgccattaaagaatgccagtgataagcgaaaccagaatctccca
gtttctttatcaagtggagtgcaaaaccccattgggacagctggagcgggccagcagtcg
gctccttcattaagcagccccaatcctatagatcccagctccatgcagagagcatatgct
gctcttggacttccctatgggaatcaggctcaaagcaccgggcagcagccagcgcagact
caggttcatcagcagattcgtaatatgaattcactaggtggtaaccagataagtcttacg
gcaggaggaatggctgttgaacagcaaacaaatctgatctctgaagcctctctgcccaca
gccttggcaagctccaactcattactaaatgacgggaacagccaaagtacagttggcaac
ctgggcactatgcctacagcagcacccccttcaactacaggagtgagaaaagcatggcat
gaacatgtaacacaggatctccggaatcaccttgtacataaactagttcaggcgatcttc
cccactccagaccctgcagccctgaaggatcggcgcatggaaaatttagtggcttatgca
agaaaagttgaaggggacatgtacgagtcggccaacagcagggacgagtattatcatttg
ctggccgaaaaaatatataaaattcagaaagagcttgaagagaagcgaaggtcacgtttg
cagaaacaaggcattatgagcaatcagccacccttacaagcccccggaacacaacctccg
acccttacacagacagcagctgcgctgggacagacacagcctgtgcggccaaccaatggc
cctatttccatgtctatgaaccgcatgcaggtagcttcagggatgaaccagttcagtagt
atgcctattgggaatgttcagatgcccacagctcctatgggcccccgtgcagcatctccg
ctcaaccaccctacacagatgaacaacatgggatcggtgccagctatggcgatgtctcca
tcccgaatgtcccagccgcaatctataataggtgcgcatgcaggcagtttgatgggcccg
acgcaaacacagaaccagttcttgcaacagaatcagtttccagccagcaccggcactata
tcagtgggattggggcagactggagcagcagctgcagtttctcagcagggacaagcacca
actgcatctttgcctatcagtaactccttgaacatgttgggcccacagacgagtcagctt
ccacgaccagctctctcccagtcaccccttcatcaaaccccaccttctgttactgcttct
gctgctgtcatgccttcagtacagcatcaagctcccactggcttgacccctcccaagccc
actgcacctgctcagccatccactccgctgcctactcctgggcagacacctgctccaact
cctggctccgtccctaattctatgcagtcacaaagcaccccaacagtgcaagcggcagcc
caagctcagctcactccacagccgccaacacctgtgcccattcaatctgtacccacgccg
caacctgcccagctgcaacctacgtctgtgcatgcaccagctcctggcactccgctatca
caggcagcagcaagtgtagataatcatgtacggaccccagcttccgttgccagcactgac
aaccagcctgcgcctgatcattctatgacggaagtgaaggtagaaggcaaaacggatgaa
ccagaggcgtgtgaaaaccaagtagagcccaaaacagaggtggaaccagatgcatcctct
caggtgaaggagcctgtgtgcgagagcactgagatcaaatcagagccaatggaggtggag
gagaagaaaactgaaataaaaacggagaacaaagaggaggaagaaaatggtggcaccaac
agttcccttcagtccacttcaccttctcagccacggaagaagatttttaaacctgaagaa
ctgcggcaagctctgatgcccacacttgaagccttatatcgacaggatccagaatcctta
ccctttcgccagcctgttgatcctcaactgctgggaatcccagattactttgacattgtg
aaaaaccctatggacttgtccaccattaaacgaaagctggacactggacagtaccaggag
ccatggcagtatgtggatgatgtctggctaatgtttaataatgcctggctgtacaacaga
aagacctcccgggtctacaaatactgcactaagcttgctgaagtctttgaacaggagatt
gatcccgtcatgcagtctcttggctattgctgtgggcgcaagtttgagttctctcctcaa
actctatgctgctatgggaagcagctgtgtaccattccacgcgatgctgcctacttcagc
tatcagaatagataccacttctgtgaaaagtgcttcacagagatccagggggagaatgtc
actttaggagatgatccttcccaacctcaaacgacaatatccaaggagcaatttgagaaa
aagaaaaatgatatgcttgatccagagccttttgtagactgcaaagagtgtgggaggaag
atgcatcagatctgtgtcctgcattttgatattatttggccttctggctttgtctgtgat
aactgcttgaaaaaaacagggaggacacggaaagaaaacaaattttgcgcaaagaggctc
caaaccacacgcttaggaaatcacctagaagatcgagtgaataagttcttgcggagacag
aatcatccagaggcaggagaagtgtccgtaagggttgtggccagttcggataaaatagtg
gaagtgagacctggaatgaaatccaagtttgtggacacaggtgaaatgccagaatccttc
ccataccgtacaaaagctctgttcgcatttgaggagattgatggtgtagacgtgtgtttc
tttggcatgcacgtgcaggaatatggctctgactgccctatgcctaacaccagacgggta
tacatctcctatctggacagtattcacttcttcagaccacgcagcctacgaactgctgtc
taccatgaaatactcattggttacttggaatatgtgaaaaaacttggctatgtcacaggg
catatctgggcttgcccaccaagtgaaggcgacgactacatatttcattgccacccgcct
gaccaaaaaatccccaagcctaaacgtctgcaggagtggtataaaaagatgctggacaag
gcttttgctgagcgcatcattcatgactataaggatatctttaagcaagcaaccgaggat
cgtctcactagtgccaaggaacttccatactttgaaggagatttctggcctaatgtatta
gaagagagcatcaaggaacttgagcaggaagaagaggaaagaaagaaggaagagaacacg
gctgcttgtgaaaccactgagggctgccaaggagatagcaaaaatgccaagaaaaaaaat
aataaaaagaccaacaaaaataaaagcagtatgagtcgcgccaacaagaagaaagcaagc
atgcctaatgtttgtaatgatctcagccagaagctctatgccaccatggagaagcataaa
gaggtgttttttgtgattcatttctatgcggggccagttattaattccctcccacccatt
gcggatccggacccgctcttgagctgtgacttaatggacggaagggatgcgttcctgact
ctagcccgtgataagcattgggagttctcatcactgcgacgttccaagtggtccacactt
tgcatgctggtggaactacacacgcaaggccaggaccgctttgtctacacctgcaatgaa
tgcaagcatcacgtggagacacgttggcactgcacagtgtgtgaggattatgatttgtgt
gtgaactgctacaatgcaaagagccacgagcacaagatggtgaaatggggtcttgggctg
gatgatgaaagtaacagccagggtgaggcacagtctaagagtccccaggagtctcgccgg
cttagcatccagagatgcatccagtccttggttcatgcctgtcagtgtcgcaatgccaat
tgttcacttccctcgtgccagaagatgaagagggtggtacagcacaccaagggttgcaag
cgcaagaccaatggtggttgccctgtttgcaagcagttgattgccttgtgttgctaccat
gctaagcactgccaagagaacaaatgcccagtgcccttctgtctaaacattaagcaaaag
ttaagacagcagcagattcaacaccggctgcagcaggcgcaacttatgcgacgacggatg
gcaactatgaatacccgagcagttccgcagcagagcctcccatcccctacctcagcaaca
cctggaacacccacacagcagccgagcaccccacaaactccacagcctgctccacaacca
tctccagtaagcatagcttcacctggctttcccagtgttcaaaggactcagcccccaaat
gtagcatcacagggcaagccaacaaatccagttccacccgtgcctccctctcagcccact
gtgcagcccccaccagctgctgttgcagctgcccggcaaatagaactagaggcccaacaa
cagcagctttacagggtcaccagcattgcagaagggataaatagtgcacgtcctggcatg
gtcaacccatctgttgggtctgtgaaccccatgcagcaaatggctatgaatgtgccacgt
cctggtcccattggtgcacctcctatcatggcaggaatgcagccaggacagtggccagcg
gcccaactccctcagcaacctcaaatgcagcagagcatccagcgaccggtgatgcaaatg
gccacggcacagcaggcagttgcaggacctcgtctggcaggcgtacccccacagcaggca
cgtaatatagcacctgcccccaatgccttgcaggatctgctgcgtaccctcaaatcacca
agctctccgcaacagcagcaacaggtgcttaatattttgaagtccaatccacacctaatg
gcagcttttattaagcaaaggactgctaagtatgtggccaaccagcctggaatgcagccc
cagcaagcaccccaacagcagcagcagccacaacagcctggtatgcatccacaagccggc
ctgcagaacatgagccccatgccggtcggggtgccaagggcagctgttccccagcagcag
ccaggtatggctccacagggccaaggcattggcttgatgaacacagctcataatactaac
ctcgcaaatataaacccgcagtaccgagagatgtatcgacgacaacaacttttacagcag
cagcagcaacaacaacaacagcagcagcagagtgcagcgggtatggccgggggattgcca
gcacatgggcagttccagcaaccgcagggagcatacccacaaccgcaagccttgcagcag
caacgcatgcagcagcatctgtctatccagggtggtaccatgggacagatccctcagatg
gcacagccggggcttggcaatgaaggttcacaggcaagccttcagcaagctttgcatcaa
cgtatccagcagcagatcaagcaacaaattgcttccggacaggctaatcccatgagccca
cagcaacaccttctgactggccaacccccctcagcccatttacccactggccagcaaatt
gcaactgctctaagtaatcaggtgcggtcaccagcccctgtccaatcacctcggcctcag
tcacagcctccacattccagcccttcaccccgtgtacagccacagccttccccgcaccac
gtttcaccccagacaggctctccccacccaggcttggcagcctctatgggtaactcccta
gaccagggtcatttgggaaatccagagcagagcgccatgcttccgcagctcaacccgccc
aatcgtagtgccctaacaaatgacttgtcccttgttggagacacttcaggggacaccttg
gaaaaatttgttgaagggttgtag

DBGET integrated database retrieval system