KEGG   Xenopus tropicalis (western clawed frog): 100101677Help
Entry
100101677         CDS       T01011                                 

Gene name
crebbp, cbp, kat3a, p300, rsts
Definition
CREB binding protein (EC:2.3.1.48)
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100101677 (crebbp)
   04330 Notch signaling pathway
    100101677 (crebbp)
   04350 TGF-beta signaling pathway
    100101677 (crebbp)
   04630 Jak-STAT signaling pathway
    100101677 (crebbp)
   04068 FoxO signaling pathway
    100101677 (crebbp)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100101677 (crebbp)
  Cell communication
   04520 Adherens junction
    100101677 (crebbp)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100101677 (crebbp)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100101677 (crebbp)
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100101677 (crebbp)
Transcription factors [BR:xtr03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100101677 (crebbp)
Mitochondrial biogenesis [BR:xtr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100101677 (crebbp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 2427 aa AA seqDB search
MAENLLDGPPNRKRPKLSSPGFSASTDSTDFVSFFDLENDLPDELIPNGGELSILGTGGN
LGQDAASQNKQLSDLLRGGNAGLGTAMGRGGSGSPVQQGMGSQGQQNSPGLGNLSSLNKS
PLNQGLSVTPPSGLTKTTTGTPGPSVPASQAQKQVSMVAGSPAAPQAPTGICMNSNFNQG
HQALLNSNSGHTLMSQAQPAQGQVLNGSLGVGNRGRGAALQYNSPAMQTNPGSVLAETLT
QGATTMPTHAGMTTAQTGAMTKMGLPGNTSPFGQTFNQATGQQIRAQGVSPQLPAKPAMA
NSLPPFPSDIKNTPVANVPNMAQVQQVGIGTTPSMGTGPTADPEKRKLIQQQLVLLLHAH
KCQRREQNNGEMRDCSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRH
DCPVCLPLKNASDKRNQNLPVSLSSGVQNPIGTAGAGQQSAPSLSSPNPIDPSSMQRAYA
ALGLPYGNQAQSTGQQPAQTQVHQQIRNMNSLGGNQISLTAGGMAVEQQTNLISEASLPT
ALASSNSLLNDGNSQSTVGNLGTMPTAAPPSTTGVRKAWHEHVTQDLRNHLVHKLVQAIF
PTPDPAALKDRRMENLVAYARKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRL
QKQGIMSNQPPLQAPGTQPPTLTQTAAALGQTQPVRPTNGPISMSMNRMQVASGMNQFSS
MPIGNVQMPTAPMGPRAASPLNHPTQMNNMGSVPAMAMSPSRMSQPQSIIGAHAGSLMGP
TQTQNQFLQQNQFPASTGTISVGLGQTGAAAAVSQQGQAPTASLPISNSLNMLGPQTSQL
PRPALSQSPLHQTPPSVTASAAVMPSVQHQAPTGLTPPKPTAPAQPSTPLPTPGQTPAPT
PGSVPNSMQSQSTPTVQAAAQAQLTPQPPTPVPIQSVPTPQPAQLQPTSVHAPAPGTPLS
QAAASVDNHVRTPASVASTDNQPAPDHSMTEVKVEGKTDEPEACENQVEPKTEVEPDASS
QVKEPVCESTEIKSEPMEVEEKKTEIKTENKEEEENGGTNSSLQSTSPSQPRKKIFKPEE
LRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQE
PWQYVDDVWLMFNNAWLYNRKTSRVYKYCTKLAEVFEQEIDPVMQSLGYCCGRKFEFSPQ
TLCCYGKQLCTIPRDAAYFSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKEQFEK
KKNDMLDPEPFVDCKECGRKMHQICVLHFDIIWPSGFVCDNCLKKTGRTRKENKFCAKRL
QTTRLGNHLEDRVNKFLRRQNHPEAGEVSVRVVASSDKIVEVRPGMKSKFVDTGEMPESF
PYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPMPNTRRVYISYLDSIHFFRPRSLRTAV
YHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDK
AFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEENT
AACETTEGCQGDSKNAKKKNNKKTNKNKSSMSRANKKKASMPNVCNDLSQKLYATMEKHK
EVFFVIHFYAGPVINSLPPIADPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTL
CMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCVNCYNAKSHEHKMVKWGLGL
DDESNSQGEAQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCK
RKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQIQHRLQQAQLMRRRM
ATMNTRAVPQQSLPSPTSATPGTPTQQPSTPQTPQPAPQPSPVSIASPGFPSVQRTQPPN
VASQGKPTNPVPPVPPSQPTVQPPPAAVAAARQIELEAQQQQLYRVTSIAEGINSARPGM
VNPSVGSVNPMQQMAMNVPRPGPIGAPPIMAGMQPGQWPAAQLPQQPQMQQSIQRPVMQM
ATAQQAVAGPRLAGVPPQQARNIAPAPNALQDLLRTLKSPSSPQQQQQVLNILKSNPHLM
AAFIKQRTAKYVANQPGMQPQQAPQQQQQPQQPGMHPQAGLQNMSPMPVGVPRAAVPQQQ
PGMAPQGQGIGLMNTAHNTNLANINPQYREMYRRQQLLQQQQQQQQQQQQSAAGMAGGLP
AHGQFQQPQGAYPQPQALQQQRMQQHLSIQGGTMGQIPQMAQPGLGNEGSQASLQQALHQ
RIQQQIKQQIASGQANPMSPQQHLLTGQPPSAHLPTGQQIATALSNQVRSPAPVQSPRPQ
SQPPHSSPSPRVQPQPSPHHVSPQTGSPHPGLAASMGNSLDQGHLGNPEQSAMLPQLNPP
NRSALTNDLSLVGDTSGDTLEKFVEGL
NT seq 7284 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaacctgctggacgggccacccaacaggaagagacccaaactgagctcgcca
ggcttctctgccagcactgacagcacagactttgtatccttctttgacttggaaaatgat
cttcctgatgagctaattcccaatggaggagaactaagcattttgggtactggcggaaac
ctggggcaagatgcagcttcccaaaataagcaactgtccgatctcctacgtggtggaaat
gcagggcttggaacagctatgggcagaggaggttctggcagtccagtgcaacagggaatg
ggatcccaggggcagcaaaatagccctggacttggaaatcttagcagtctcaacaagagc
ccactcaatcagggcctatctgttactccaccctcgggacttaccaagacaacaactggt
acacctggtccttcggttcctgcctctcaagcacaaaagcaagtcagtatggtggcgggc
agtccggccgctccacaggcacctacaggaatctgcatgaactcaaactttaatcaaggg
catcaggcactgctaaatagtaactctgggcacacactaatgagccaggcccagccagca
cagggacaggtccttaatgggtctttaggcgttggaaacagaggtcgaggggctgctctt
cagtacaactcacctgccatgcaaactaatccaggaagtgtcctggcagaaacattaaca
caaggagcaacaactatgccaacacatgcaggaatgacaactgcccagactggagccatg
actaagatgggacttccaggcaacactagtccttttgggcagacatttaaccaagctaca
ggtcagcaaatccgagcccagggggtcagccctcagctgcctgcaaagcctgccatggca
aacagccttcctcctttcccctctgacatcaaaaatacccctgttgctaatgtacccaat
atggctcaggtgcagcaagttggtattggcacaacgccgtccatgggaactggcccaaca
gctgacccagagaagcgcaagcttatacagcaacaacttgtcctactgcttcatgcacac
aagtgtcagcggcgagagcagaataatggcgaaatgagggactgctccctgcctcattgt
cgcaccatgaagaacgtgcttaaccacatgacccattgccaggccgggaaggcctgccaa
gttgcccactgtgcttcctcaagacaaatcatctctcactggaaaaactgtacgcggcat
gactgtcctgtgtgcctgccattaaagaatgccagtgataagcgaaaccagaatctccca
gtttctttatcaagtggagtgcaaaaccccattgggacagctggagcgggccagcagtcg
gctccttcattaagcagccccaatcctatagatcccagctccatgcagagagcatatgct
gctcttggacttccctatgggaatcaggctcaaagcaccgggcagcagccagcgcagact
caggttcatcagcagattcgtaatatgaattcactaggtggtaaccagataagtcttacg
gcaggaggaatggctgttgaacagcaaacaaatctgatctctgaagcctctctgcccaca
gccttggcaagctccaactcattactaaatgacgggaacagccaaagtacagttggcaac
ctgggcactatgcctacagcagcacccccttcaactacaggagtgagaaaagcatggcat
gaacatgtaacacaggatctccggaatcaccttgtacataaactagttcaggcgatcttc
cccactccagaccctgcagccctgaaggatcggcgcatggaaaatttagtggcttatgca
agaaaagttgaaggggacatgtacgagtcggccaacagcagggacgagtattatcatttg
ctggccgaaaaaatatataaaattcagaaagagcttgaagagaagcgaaggtcacgtttg
cagaaacaaggcattatgagcaatcagccacccttacaagcccccggaacacaacctccg
acccttacacagacagcagctgcgctgggacagacacagcctgtgcggccaaccaatggc
cctatttccatgtctatgaaccgcatgcaggtagcttcagggatgaaccagttcagtagt
atgcctattgggaatgttcagatgcccacagctcctatgggcccccgtgcagcatctccg
ctcaaccaccctacacagatgaacaacatgggatcggtgccagctatggcgatgtctcca
tcccgaatgtcccagccgcaatctataataggtgcgcatgcaggcagtttgatgggcccg
acgcaaacacagaaccagttcttgcaacagaatcagtttccagccagcaccggcactata
tcagtgggattggggcagactggagcagcagctgcagtttctcagcagggacaagcacca
actgcatctttgcctatcagtaactccttgaacatgttgggcccacagacgagtcagctt
ccacgaccagctctctcccagtcaccccttcatcaaaccccaccttctgttactgcttct
gctgctgtcatgccttcagtacagcatcaagctcccactggcttgacccctcccaagccc
actgcacctgctcagccatccactccgctgcctactcctgggcagacacctgctccaact
cctggctccgtccctaattctatgcagtcacaaagcaccccaacagtgcaagcggcagcc
caagctcagctcactccacagccgccaacacctgtgcccattcaatctgtacccacgccg
caacctgcccagctgcaacctacgtctgtgcatgcaccagctcctggcactccgctatca
caggcagcagcaagtgtagataatcatgtacggaccccagcttccgttgccagcactgac
aaccagcctgcgcctgatcattctatgacggaagtgaaggtagaaggcaaaacggatgaa
ccagaggcgtgtgaaaaccaagtagagcccaaaacagaggtggaaccagatgcatcctct
caggtgaaggagcctgtgtgcgagagcactgagatcaaatcagagccaatggaggtggag
gagaagaaaactgaaataaaaacggagaacaaagaggaggaagaaaatggtggcaccaac
agttcccttcagtccacttcaccttctcagccacggaagaagatttttaaacctgaagaa
ctgcggcaagctctgatgcccacacttgaagccttatatcgacaggatccagaatcctta
ccctttcgccagcctgttgatcctcaactgctgggaatcccagattactttgacattgtg
aaaaaccctatggacttgtccaccattaaacgaaagctggacactggacagtaccaggag
ccatggcagtatgtggatgatgtctggctaatgtttaataatgcctggctgtacaacaga
aagacctcccgggtctacaaatactgcactaagcttgctgaagtctttgaacaggagatt
gatcccgtcatgcagtctcttggctattgctgtgggcgcaagtttgagttctctcctcaa
actctatgctgctatgggaagcagctgtgtaccattccacgcgatgctgcctacttcagc
tatcagaatagataccacttctgtgaaaagtgcttcacagagatccagggggagaatgtc
actttaggagatgatccttcccaacctcaaacgacaatatccaaggagcaatttgagaaa
aagaaaaatgatatgcttgatccagagccttttgtagactgcaaagagtgtgggaggaag
atgcatcagatctgtgtcctgcattttgatattatttggccttctggctttgtctgtgat
aactgcttgaaaaaaacagggaggacacggaaagaaaacaaattttgcgcaaagaggctc
caaaccacacgcttaggaaatcacctagaagatcgagtgaataagttcttgcggagacag
aatcatccagaggcaggagaagtgtccgtaagggttgtggccagttcggataaaatagtg
gaagtgagacctggaatgaaatccaagtttgtggacacaggtgaaatgccagaatccttc
ccataccgtacaaaagctctgttcgcatttgaggagattgatggtgtagacgtgtgtttc
tttggcatgcacgtgcaggaatatggctctgactgccctatgcctaacaccagacgggta
tacatctcctatctggacagtattcacttcttcagaccacgcagcctacgaactgctgtc
taccatgaaatactcattggttacttggaatatgtgaaaaaacttggctatgtcacaggg
catatctgggcttgcccaccaagtgaaggcgacgactacatatttcattgccacccgcct
gaccaaaaaatccccaagcctaaacgtctgcaggagtggtataaaaagatgctggacaag
gcttttgctgagcgcatcattcatgactataaggatatctttaagcaagcaaccgaggat
cgtctcactagtgccaaggaacttccatactttgaaggagatttctggcctaatgtatta
gaagagagcatcaaggaacttgagcaggaagaagaggaaagaaagaaggaagagaacacg
gctgcttgtgaaaccactgagggctgccaaggagatagcaaaaatgccaagaaaaaaaat
aataaaaagaccaacaaaaataaaagcagtatgagtcgcgccaacaagaagaaagcaagc
atgcctaatgtttgtaatgatctcagccagaagctctatgccaccatggagaagcataaa
gaggtgttttttgtgattcatttctatgcggggccagttattaattccctcccacccatt
gcggatccggacccgctcttgagctgtgacttaatggacggaagggatgcgttcctgact
ctagcccgtgataagcattgggagttctcatcactgcgacgttccaagtggtccacactt
tgcatgctggtggaactacacacgcaaggccaggaccgctttgtctacacctgcaatgaa
tgcaagcatcacgtggagacacgttggcactgcacagtgtgtgaggattatgatttgtgt
gtgaactgctacaatgcaaagagccacgagcacaagatggtgaaatggggtcttgggctg
gatgatgaaagtaacagccagggtgaggcacagtctaagagtccccaggagtctcgccgg
cttagcatccagagatgcatccagtccttggttcatgcctgtcagtgtcgcaatgccaat
tgttcacttccctcgtgccagaagatgaagagggtggtacagcacaccaagggttgcaag
cgcaagaccaatggtggttgccctgtttgcaagcagttgattgccttgtgttgctaccat
gctaagcactgccaagagaacaaatgcccagtgcccttctgtctaaacattaagcaaaag
ttaagacagcagcagattcaacaccggctgcagcaggcgcaacttatgcgacgacggatg
gcaactatgaatacccgagcagttccgcagcagagcctcccatcccctacctcagcaaca
cctggaacacccacacagcagccgagcaccccacaaactccacagcctgctccacaacca
tctccagtaagcatagcttcacctggctttcccagtgttcaaaggactcagcccccaaat
gtagcatcacagggcaagccaacaaatccagttccacccgtgcctccctctcagcccact
gtgcagcccccaccagctgctgttgcagctgcccggcaaatagaactagaggcccaacaa
cagcagctttacagggtcaccagcattgcagaagggataaatagtgcacgtcctggcatg
gtcaacccatctgttgggtctgtgaaccccatgcagcaaatggctatgaatgtgccacgt
cctggtcccattggtgcacctcctatcatggcaggaatgcagccaggacagtggccagcg
gcccaactccctcagcaacctcaaatgcagcagagcatccagcgaccggtgatgcaaatg
gccacggcacagcaggcagttgcaggacctcgtctggcaggcgtacccccacagcaggca
cgtaatatagcacctgcccccaatgccttgcaggatctgctgcgtaccctcaaatcacca
agctctccgcaacagcagcaacaggtgcttaatattttgaagtccaatccacacctaatg
gcagcttttattaagcaaaggactgctaagtatgtggccaaccagcctggaatgcagccc
cagcaagcaccccaacagcagcagcagccacaacagcctggtatgcatccacaagccggc
ctgcagaacatgagccccatgccggtcggggtgccaagggcagctgttccccagcagcag
ccaggtatggctccacagggccaaggcattggcttgatgaacacagctcataatactaac
ctcgcaaatataaacccgcagtaccgagagatgtatcgacgacaacaacttttacagcag
cagcagcaacaacaacaacagcagcagcagagtgcagcgggtatggccgggggattgcca
gcacatgggcagttccagcaaccgcagggagcatacccacaaccgcaagccttgcagcag
caacgcatgcagcagcatctgtctatccagggtggtaccatgggacagatccctcagatg
gcacagccggggcttggcaatgaaggttcacaggcaagccttcagcaagctttgcatcaa
cgtatccagcagcagatcaagcaacaaattgcttccggacaggctaatcccatgagccca
cagcaacaccttctgactggccaacccccctcagcccatttacccactggccagcaaatt
gcaactgctctaagtaatcaggtgcggtcaccagcccctgtccaatcacctcggcctcag
tcacagcctccacattccagcccttcaccccgtgtacagccacagccttccccgcaccac
gtttcaccccagacaggctctccccacccaggcttggcagcctctatgggtaactcccta
gaccagggtcatttgggaaatccagagcagagcgccatgcttccgcagctcaacccgccc
aatcgtagtgccctaacaaatgacttgtcccttgttggagacacttcaggggacaccttg
gaaaaatttgttgaagggttgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system