KEGG   Xenopus tropicalis (western clawed frog): 100101696Help
Entry
100101696         CDS       T01011                                 

Gene name
ppt2, g14, ng3
Definition
palmitoyl-protein thioesterase 2 (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:xtr01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:xtr00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:xtr04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 296 aa AA seqDB search
MTSPSPKALPTFYLLLPLLVWMVGHSLCYKPVIVIHGLFDSSANFKNLLQYINESHPGTN
VTVLDLFDNKESLQPLWKQVQGFKEAIYPIMQNAGRDGVHLLCYSQGGLICRGLLQTMPD
HNVDTFISLSSPQMGQYGDTDYLRYLFPKYVKSNLYRLCYTQLGQTFSICNFWNDPHHHG
IYVNVSDFLAPLNSERPEPNATDWKKNFLRLRKMVLIGGPDDGVITPWESSHFGFYDENE
TVLEMKYQMVYQDDTFGLRSMDYRGAVSVYSVPGVAHTMWHSNQTVFNNCIEKWLT
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacccagtccaaaagctttgccaacattttaccttctgttacctcttctggtt
tggatggtcggccactcattgtgctacaagccagtcattgtgattcatggattgtttgac
agctcagccaactttaagaatctcttgcagtatatcaatgagtctcacccaggaaccaat
gtcacagtattggacctgtttgataacaaggagagtttgcagcctctgtggaagcaggtg
caaggtttcaaagaagcaatctatccaataatgcaaaatgcaggcagggatggagtgcac
ctgctatgttactcccagggagggttgatttgccgtggtcttttgcagaccatgccagac
cacaatgtggatacttttatttctctctcttccccacaaatgggccagtatggagacaca
gattatctacggtatctgttccccaaatatgtgaaatccaacttgtaccgattgtgttac
acacagctgggtcagaccttttccatctgcaacttttggaatgatccacatcaccatggt
atatacgtaaatgttagtgattttcttgccccgctgaactccgaaaggccagagcccaat
gccacagactggaagaagaatttcctgcgcctccgtaaaatggttcttattgggggccct
gatgatggggttattaccccatgggagtctagtcactttgggttttatgatgaaaatgaa
acagttttggaaatgaaatatcaaatggtgtaccaagatgacacgtttggacttcgctca
atggattaccgaggagcagtctctgtatattctgtgccaggggttgctcacactatgtgg
cattcaaaccagacagttttcaacaactgcattgaaaaatggcttacttaa

DBGET integrated database retrieval system