KEGG   Xenopus tropicalis (western clawed frog): 100101696Help
Entry
100101696         CDS       T01011                                 

Gene name
ppt2, g14, ng3, ppt2-a, ppt2-b
Definition
(RefSeq) palmitoyl-protein thioesterase 2
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00062  Fatty acid elongation
xtr01100  Metabolic pathways
xtr01212  Fatty acid metabolism
xtr04142  Lysosome
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    100101696 (ppt2)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100101696 (ppt2)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100101696 (ppt2)
Lipid biosynthesis proteins [BR:xtr01004]
 Fatty acid synthase
  Component type
   100101696 (ppt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest Abhydrolase_1 DUF676 Lipase_2 PGAP1 Hydrolase_4 PPO1_DWL
Motif
Other DBs
NCBI-GeneID: 100101696
NCBI-ProteinID: NP_001093688
Xenbase: XB-GENE-478972
UniProt: A4QNL5
Position
8
AA seq 296 aa AA seqDB search
MTSPSPKALPTFYLLLPLLVWMVGHSLCYKPVIVIHGLFDSSANFKNLLQYINESHPGTN
VTVLDLFDNKESLQPLWKQVQGFKEAIYPIMQNAGRDGVHLLCYSQGGLICRGLLQTMPD
HNVDTFISLSSPQMGQYGDTDYLRYLFPKYVKSNLYRLCYTQLGQTFSICNFWNDPHHHG
IYVNVSDFLAPLNSERPEPNATDWKKNFLRLRKMVLIGGPDDGVITPWESSHFGFYDENE
TVLEMKYQMVYQDDTFGLRSMDYRGAVSVYSVPGVAHTMWHSNQTVFNNCIEKWLT
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacccagtccaaaagctttgccaacattttaccttctgttacctcttctggtt
tggatggtcggccactcattgtgctacaagccagtcattgtgattcatggattgtttgac
agctcagccaactttaagaatctcttgcagtatatcaatgagtctcacccaggaaccaat
gtcacagtattggacctgtttgataacaaggagagtttgcagcctctgtggaagcaggtg
caaggtttcaaagaagcaatctatccaataatgcaaaatgcaggcagggatggagtgcac
ctgctatgttactcccagggagggttgatttgccgtggtcttttgcagaccatgccagac
cacaatgtggatacttttatttctctctcttccccacaaatgggccagtatggagacaca
gattatctacggtatctgttccccaaatatgtgaaatccaacttgtaccgattgtgttac
acacagctgggtcagaccttttccatctgcaacttttggaatgatccacatcaccatggt
atatacgtaaatgttagtgattttcttgccccgctgaactccgaaaggccagagcccaat
gccacagactggaagaagaatttcctgcgcctccgtaaaatggttcttattgggggccct
gatgatggggttattaccccatgggagtctagtcactttgggttttatgatgaaaatgaa
acagttttggaaatgaaatatcaaatggtgtaccaagatgacacgtttggacttcgctca
atggattaccgaggagcagtctctgtatattctgtgccaggggttgctcacactatgtgg
cattcaaaccagacagttttcaacaactgcattgaaaaatggcttacttaa

DBGET integrated database retrieval system