KEGG   Xenopus tropicalis (western clawed frog): 100101766Help
Entry
100101766         CDS       T01011                                 

Gene name
mapk11, p38-2, p38b, p38beta, p38beta2, prkm11, sapk2, sapk2b
Definition
mitogen-activated protein kinase 11 (EC:2.7.11.1)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Salmonella infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100101766 (mapk11)
   04370 VEGF signaling pathway
    100101766 (mapk11)
   04068 FoxO signaling pathway
    100101766 (mapk11)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100101766 (mapk11)
   04621 NOD-like receptor signaling pathway
    100101766 (mapk11)
   04622 RIG-I-like receptor signaling pathway
    100101766 (mapk11)
  Endocrine system
   04912 GnRH signaling pathway
    100101766 (mapk11)
   04914 Progesterone-mediated oocyte maturation
    100101766 (mapk11)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100101766 (mapk11)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100101766 (mapk11)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100101766 (mapk11)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100101766 (mapk11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 361 aa AA seqDB search
MSGRVGFYKQELNKTVWEVPDRYQRLTPVGSGAFGSVCSAYDTKTRQKVAVKKLSRPFQS
LVHARRTYRELRLLKHMKHENVIGLLDVFTPSTSGENFNEVYLVTNLMGADLNNIVKCQK
LTDDHIQFLIYQLLRGLKYIHSAGIIHRDLKPSNLAVNEDCELRILDFGLARQADDEMTG
YVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLKGKALFPGNDYIDQLKRIMEVVGT
PNSEFLLKISSEHARRYIESLPYMPQQDLKEVFHGANPLAIDLLEKMLILDSDKRITATE
ALAHPYFVQYHDPDDEPEAEPYDESTENKERTIDEWKEITYEEVISFKSQDVKIDNLEIE
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggcgcgttggattctacaagcaagagctgaacaaaacggtgtgggaggtgccg
gaccggtaccagcgccttacccctgttggttccggtgcttttggctctgtatgctctgca
tatgataccaagacaagacaaaaggtggcagtaaaaaagctctccaggccatttcagtca
ctagtccatgcaaggcgaacgtacagggaactgcggctgctgaaacatatgaagcatgag
aatgttattggcttgctggatgttttcacgccatctacttcaggagaaaattttaatgaa
gtgtatctagtgacaaatctaatgggagccgacctcaataatattgtaaagtgccaaaag
ttaacagatgaccatatccaattccttatatatcagttacttagaggcctcaagtatata
cactctgctggaatcatccatagagacttgaagcccagcaatttagcagtaaatgaggac
tgtgaactaaggattctagattttggcttggcacggcaggcagatgatgaaatgactggg
tatgttgcaacaaggtggtacagagctcctgaaatcatgttgaattggatgcattataat
caaacagttgacatttggtcagttggatgcatcatggcagagctactgaaaggcaaagct
ctctttccaggaaatgattacattgatcaattaaaaaggataatggaagtagtcggaaca
cccaactcagaatttctcctgaaaatatcatcagaacatgccagaagatacattgaatca
ttaccttatatgcctcagcaagatctgaaggaggtatttcatggtgccaacccactggcg
attgatctgcttgaaaagatgctcattttagacagtgacaagaggataactgctacagaa
gccctggcacatccttattttgtacaatatcatgacccagacgatgagcctgaagctgaa
ccttatgacgaatcaacggaaaataaagagcgcactatagatgaatggaaagaaattaca
tatgaagaagtcattagctttaaatctcaagatgttaaaattgataacttggagattgaa
cagtaa

DBGET integrated database retrieval system