KEGG   Xenopus tropicalis (western clawed frog): 100124300Help
Entry
100124300         CDS       T01011                                 

Gene name
cdc25c, cdc25, xcdc25c
Definition
cell division cycle 25C (EC:3.1.3.48)
Orthology
K05867  
M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100124300 (cdc25c)
   04114 Oocyte meiosis
    100124300 (cdc25c)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100124300 (cdc25c)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100124300 (cdc25c)
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100124300 (cdc25c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 560 aa AA seqDB search
MFQTSSGGSAEVMAENHIMSSEAPPKSNQGLHFRTNCRMILNLLREKDSSVTFSPEQPLT
PVTDLAVGFSNLSTFTGETPKRCLDLSNLGDETGPLPTESPDRMSLGKVESPKTQFVQFE
FTPDLGCKAKKCQRGNMNSVLPRLLCSTPSFKKTSGGQRSMSNKENESELFKNPNCKPAA
LVLPQEAVDSQFSPAPEDKVDISLDEDCEMNILGSPISAAAPCLEGPHDDIKMQNLDGFA
DFFSVDEEEIENPSGAVGNLSSSMAILLSGPLLNQEVEVSNVNNISLNRSRLYRSPSMPE
KLDRPMLKRTVRPQDSETPVRIKRRRSTSSPLQPEEENCQPRRRGTSLKKTLSLCDVDIS
TVLDEDCGHRQLIGDFSKVYALPTVTGRHQDLRYITAETLAALIHGDFSSLVENVFIIDC
RYPYEYDGGHIKGALNLHRQEEVTDYFLKQPLAPSVAQKRLIIVFHCEFSSERGPKMCRF
LREEDRARNEYPGLYYPELYLLKGGYKDFFPEYKELCEPQGYCPMHHQDFREELLKFRTK
CKTSVGDRKRREQIARLMKL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgttccagacaagtagtggaggctcggctgaagtcatggcagagaatcacataatgtca
tcagaagcacccccaaagtccaaccaaggcctgcatttccgtacaaattgcagaatgata
ttaaacctccttcgtgaaaaagattcctcagttacattttctcctgaacagcctttgaca
cctgtcactgaccttgctgttggatttagtaacctaagtaccttcactggtgaaactccc
aaacgctgcctggacttgtccaaccttggtgatgagactgggccactgccaacagagtcc
cctgacagaatgtcattaggcaaagtggagtcaccaaagacacaatttgtccagtttgaa
tttacgccagatctaggatgcaaagccaaaaagtgtcagagaggaaacatgaattctgtt
ctgcctcgccttctttgtagtactccaagttttaaaaagacctcaggaggacagagaagc
atgtccaataaggaaaatgagagtgaattgtttaaaaatccaaactgcaaacctgctgct
ttggtgctgccacaagaagcagtcgattcacaattctctccagcaccagaggacaaggtt
gatatctccctagacgaggattgtgagatgaatatcttgggttccccaataagtgcagct
gccccttgtttggagggaccacatgatgacatcaaaatgcaaaatcttgatggatttgca
gattttttttcagttgatgaagaggagattgagaatccctctggagctgttggtaacttg
tcctctagcatggcaattcttctgtcaggacctcttttaaatcaagaagtagaagtcagc
aatgtaaacaatatatctttaaacagaagccgtctttaccgctcaccatctatgccagag
aaacttgacaggccgatgcttaaacgcacagtgaggccacaagacagtgaaacacctgtc
agaattaaaaggagacgcagtaccagcagcccccttcaacctgaggaagagaactgccaa
ccaaggaggaggggtacatctcttaaaaagacactttctctttgtgacgtggatattagc
acagttttggatgaagactgtggtcacagacaacttattggagatttttcaaaggtttat
gctttacccactgtaactggccgacaccaggacctccgctacatcactgcagagactctg
gcagccttaattcatggagacttcagcagtttagtggagaatgtctttataatagattgt
cgttatccttatgaatatgacggcgggcacatcaagggtgcattaaacctccaccggcaa
gaggaagtaactgactacttcctgaaacaacctctggctccatcggtggcacagaagcga
ttaattatagtttttcattgcgagttctcttctgaaagaggcccaaaaatgtgtcgcttc
cttagggaggaagacagagccaggaatgagtacccaggcttgtattacccagagctttat
ctccttaaaggcggttacaaggatttttttcctgaatacaaggagctatgtgagccacag
ggctactgcccaatgcaccatcaggatttccgggaggagcttctgaaatttcggacaaaa
tgtaagacatcagttggtgatagaaagagaagggaacagattgcccgcctgatgaagctt
taa

DBGET integrated database retrieval system