KEGG   Xenopus tropicalis (western clawed frog): 100124302Help
Entry
100124302         CDS       T01011                                 

Gene name
usp7, hausp, tef1
Definition
ubiquitin specific peptidase 7 (herpes virus-associated)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
FoxO signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100124302 (usp7)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100124302 (usp7)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100124302 (usp7)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100124302 (usp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 1102 aa AA seqDB search
MNHHQQQQQQKPGEQQLSEPEDMEMEAGDTDDPPRITPNPVINGNVAMADGHNNTEEDME
DDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQ
CNAESDSTSWSCHAQAVLKIINYKDEEKFFSRRISHLFFHKENDWGFSNFMAWSEVTDPE
KGFIEDDKVTFEVYVQADAPHGVSWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRK
AVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELC
RVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNI
FESFIDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTFPPVLHLQLMRFMYDPQTDQNIK
INDRFEFPEQLPLDEFLQKPDSKDPANYILHAVLVHSGDNHGGHYVVYLNPKGEGKWCKF
DDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDQDIPQQL
VERLQEEKRIEAQKRKERQEAHLYMQVQIVTEDQFCGHQGNDMYDEEKVKYTVFKVLKNS
TLAEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDYEADCSKTMIELSDNENPWTI
FLETVDPEMAASGATLPKFDKDHDVMLFLKMYDPKSRSLNYCGHIYTPISCKIRDLLPVM
CERAGFPQGTNLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSEL
PTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYSHVAKTVAQRLNTDPMLLQFF
KSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCVWLN
SQFREEEVTLYPDKHGCVRDLLEECKRAVELSEKGSGKLRLLEIVSYKIIGVHQEDELLE
CLSPATSRTFRIEEIPLDQVEIDKENEMLITVAHFHKEVFGTFGIPFLLRIQQGEPFREV
MKRIQSMLDIQEKEFEKFKFAIVMMGRHQYINEEDYEVSLKDFEPQPGNMSHPRPWLGLD
HFNKAPKRSRYTYLEKAIKIHN
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccatcagcagcaacaacaacagaaacccggggagcagcaactcagcgaaccc
gaggacatggagatggaagctggcgacactgatgatcccccgagaatcactccaaatcct
gtcattaatggcaatgttgccatggcagatggtcataacaacacagaagaggatatggaa
gatgatacaagctggagatcagaagctacatttcagttcacagtggaacgcttcagtcgt
ctcagtgaatctgtgcttagccctccttgctttgtacggaatctcccttggaaaatcatg
gtgatgccacgattttatccagaccgaccgcatcagaaaagtgtgggatttttccttcag
tgtaatgcggaatctgattcaacgtcatggtcctgtcatgcacaggcagtactgaagata
atcaattacaaagatgaggagaaattttttagtcgccgcataagtcacctgttctttcat
aaggaaaatgattggggcttttccaattttatggcatggagcgaggttactgatccagaa
aaaggttttatagaagatgacaaggtgactttcgaagtttatgtgcaggctgatgctcct
catggagtatcgtgggattcaaagaagcacactgggtatgttgggttgaagaatcaagga
gcaacttgttacatgaacagtttattgcaaacattattttttacaaaccaacttcgaaag
gctgtgtatatgatgcccactgaaggtgatgactcctctaaaagtgtccctttagcatta
caacgagtattttatgaattacaacacagtgacaagcctgtaggaactaaaaaattaact
aaatcttttgggtgggagacattagacagctttatgcagcatgatgtccaagaattatgt
agagtgttactggataatgttgaaaacaaaatgaaaggcacctgtgtagaaggaaccata
cctaagttatttagaggaaagatggtgtcttatatacagtgcaagcatgtagactatcgc
tctgaacgcatagaagattattatgatatccagcttagtataaaaggaaagaaaaacata
tttgagtcattcattgactatgtagcagtggagcagcttgatggtgataacaaatatgat
gcaggagaacatggtttacaggaagcagaaaaaggggtgaagtttctaacattcccgcct
gtattacatcttcaacttatgaggtttatgtatgaccctcaaacagaccagaatattaag
atcaatgacagatttgaatttccagaacagttgccgctggatgaatttctccaaaagcca
gatagcaaggatcctgctaactacattttgcatgcagttttggtgcatagtggagacaac
catggagggcactatgttgtttatttgaatcctaaaggagaaggcaaatggtgtaagttt
gacgacgatgtagtgtcaagatgtacaaaagaagaggcaatcgaacataactatggaggc
catgatgatgacttatctgtgcgacactgcacaaatgcctatatgttagtttatatcagg
gaatccaaacttagtgaggttttacaagcagtcacagatcaagatatccctcagcagctt
gttgagagattacaagaagaaaagagaattgaagcacagaaaagaaaagagcgacaagaa
gctcatctttatatgcaagtacagattgtgactgaggaccagttttgtgggcaccaaggc
aacgatatgtacgatgaagaaaaagttaaatacactgtgtttaaagtgttaaagaactca
acactggcagaatttgttcagaatctttcacagaccatgggatttccacaggatcaaatc
cgactatggcccatgcaagctaggagtaatggaacaaaaaggccagcaatgttggattat
gaagctgattgcagcaaaactatgattgaacttagtgacaatgaaaatccttggacaata
tttttggaaaccgttgatccagaaatggctgctagtggggcaacacttcctaaatttgac
aaagatcatgatgtgatgctgttcctcaaaatgtacgatcctaaaagtagaagcttgaac
tactgtggtcatatctacacaccaatttcttgtaaaatacgtgacttactgccagtgatg
tgtgagagagcaggatttccgcaaggaactaaccttatcctctatgaggaagtaaaaccg
aatttaactgaaagaattcaagattatgatgtatctcttgataaagcacttgatgagctt
atggatggtgatattatagtgtttcaaaaggatgacccagaaaatgacaacagtgaattg
ccaactgcaaaggaatacttcagagacctttaccatcgtgttgatgtcattttctgtgac
aaaactattcctaatgacccaggatttgttgtaacattatcaaatagaatgaactactca
catgttgcaaagactgttgcacagagacttaacactgacccaatgcttctacagttcttc
aaatctcaaggttacagagatggccctggaaacccccttaggcataactatgaaggtaca
ttaagagatcttctgcaattctttaaacctcggcaaccaaagaaactgtactatcagcag
cttaaaatgaaaattacagactttgaaaacaggagaagcttcaagtgtgtttggcttaat
agtcagtttagggaagaggaagtaacactatatccagacaaacacggttgtgtacgagat
cttttagaagaatgtaaaagagccgttgaactatctgagaaaggatcgggtaaattaagg
ctgctagaaattgtaagttacaaaataattggggttcaccaggaagacgagctgttagaa
tgtttatcacctgcaacaagtcggacatttcgaatagaggaaattcctctggaccaggta
gagatagataaagaaaatgaaatgttgatcacagtggcacattttcacaaagaggtgttt
ggcacatttggaatcccatttttgctaaggatacaacagggtgaacccttcagagaggta
atgaagcgaattcaatctatgctggatattcaagaaaaggaatttgaaaagttcaagttt
gccattgtaatgatgggtcggcaccaatacattaatgaagaggactacgaagtgagtcta
aaggactttgagccccagcctggtaacatgtcccatcccaggccttggctagggcttgac
cacttcaataaagccccaaagagaagtcgctacacataccttgagaaagcaattaaaatt
cataactga

DBGET integrated database retrieval system