KEGG   Xenopus tropicalis (western clawed frog): 100124309Help
Entry
100124309         CDS       T01011                                 

Gene name
usp8, humorf8, ubpy
Definition
ubiquitin specific peptidase 8
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100124309 (usp8)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100124309 (usp8)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100124309 (usp8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 1059 aa AA seqDB search
MPTVSALPKELYLSSSLSDLKKKAEVKPDKTSTKSYVSSACKIFQKAEECRLEGDEEKAY
VFYMKYLFVFELLKKRSDFKQNQDYYKSLLGPSTILKSVEEAEKLSESLKNRYEEAEVRK
KLEERERQEDLKKKEGKLFPKDFPEDVPKPNQNEMVNGEKNEVLSKRPEPTNVPHGAITV
EKLFEMTNDYNISIIIMDVRSTKDFQESHIRTSISVPEEAIIPGFTSSKIETNLPDTSKE
MWNKRGQVDFIILLDWFSSVNNLKVGTTLQSLKDALYKWETKTILRSEPLVLEGGYENWL
LCYPMFTTNGKVTVPRKRTQESVSLSLDFSYPSLEEPALPPPPPPPVCIKESSYEDTINA
VKTQKTEEPVHVVQKDDPVPDAQTPDSVKVCQPQKTVKVIPQIDRTKKPSVKVTESSSKF
KHEAKENQPIQNGRPIPDRSTKPSLDTKSVKSEIHVQFDKNIKEKGEEIKGKVDMHAENN
IDNTCAHEEKENKKRNEEKETEMDEFHRKEELEKKQPVVAGKEPAETKRLESNKPPPDDR
KKNGHSSVTPQEPSAHKKEHNSDVTVKDSCEDDRPKREPLVRARSEEMGRTVPGMPEGWV
KFLEPVTGTYRYYHSPTHTVHMYPPEMAPSSTPSTTPAQKAKVQATTDIDKEQTKLKRSY
SSPDLTQAIKDEDKKKPMPHINRENKPSIVTKAEITKLPASKIRSLNPVFGGAGPALTGL
RNLGNTCYMNSILQCLCNTPHLIEYFNNNFYQAHINRSNLLGHKGEVAEEFGCIMRALWT
GQYKYISPKDFKITIGKINEQFAGYTHQDSQELLLFLMDGLHEDLNKKADNRKRQKEENN
DHLSDSQAADSAWYKHKQLNESIIVALFQGQFKSTVQCLTCQKKSRTFEAFMYLSLPLPS
TSKCSLQDCIKAFAKEEKLTDSNRFDCSNCKTQRVATKKIEIWKLPPILLVHLKRFSFEG
RWRQKLQSYVDFPLESLDLSQYVIGPKNVKTYNLFGVSNHYGGLDGGHYTAYCKNALKQR
WFKFDDHDVSEISVSSVKTSAAYMLFYTSLDARGLEISA
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atgcctacagtatcagcacttcccaaagaactgtatctctctagctctctatctgatctt
aagaagaaagctgaagttaaacctgacaagactagcactaaaagctatgtttcctctgct
tgtaaaatatttcaaaaagcagaagaatgcagactagaaggagatgaagaaaaagcctat
gtcttttatatgaaatatttatttgtgtttgaactccttaaaaaaagatcagattttaag
cagaatcaggactattataagtccttacttggcccctccactatcttaaaatctgttgaa
gaagcggaaaaactctcagaaagccttaaaaatagatatgaagaagctgaagttcgaaaa
aaattagaggaaagggaaagacaagaagacctgaagaaaaaggagggaaaactatttccc
aaagactttcctgaagatgtacccaagcctaatcaaaatgaaatggtgaatggggagaaa
aatgaagttctttcaaagcggccagaacctactaatgtgcctcatggagctatcacagtt
gaaaagctttttgagatgacaaatgattataatatcagtataattataatggatgttcgg
agtacaaaagactttcaggagtctcatattcgtacttcaataagcgtgccagaggaggcc
ataatcccaggatttacctcaagcaagattgaaactaatctacctgatacatctaaagaa
atgtggaataaaagaggtcaagttgattttattatattgcttgattggttcagctctgta
aataacttaaaagttggtacaacacttcagagcttaaaagatgctctgtataagtgggaa
acaaaaacaatcctacggagtgaacctttagttttggaaggtggttatgaaaattggctt
ctttgttatcccatgttcacaacaaatgggaaagtgactgtgcccaggaaaagaacacaa
gaatctgtgtctttgtcattggacttcagttatccatctctagaagaaccagcacttcca
ccaccaccaccaccccctgtatgcatcaaagaaagcagctatgaggatactataaatgca
gtgaaaactcaaaaaacagaggaacctgtccatgtagtacaaaaggatgaccctgtacca
gatgctcagactccagattctgttaaagtctgtcagccacagaaaactgtgaaagttatt
ccacaaattgatcggacaaagaaaccttcagtaaaagttactgaaagttcctcaaagttt
aaacatgaagccaaagaaaaccagccaatacagaatggaaggcctataccagaccgttcc
acaaaaccatcactagacactaaatcggtcaaatcggagatccatgttcagtttgataaa
aacataaaggaaaagggtgaagaaattaaagggaaagtagatatgcatgcagaaaacaat
attgataacacatgtgcacatgaagaaaaagaaaacaaaaagaggaatgaagagaaagaa
actgagatggatgagttccacagaaaggaggagttagaaaaaaaacagccagtagttgct
ggaaaagaacctgctgaaacaaaaaggctggaaagtaataagcctccccctgatgataga
aagaagaatggccattcttctgttactcctcaagagccttctgcacataaaaaagaacat
aattctgatgtgactgtgaaagacagctgtgaagacgacagacccaaacgggaaccttta
gttcgagcaagaagtgaggagatgggtagaactgtgccaggaatgccagaaggttgggtg
aagttccttgaacctgtcactggaacctaccgatattatcattcaccaacacacactgtt
catatgtatcctcctgaaatggctccttcatccaccccttcaaccactccagctcagaaa
gccaaggtacaggctactactgacattgataaagagcagaccaagttaaaacgatcttac
tcctcgcctgatttaacgcaagccataaaagatgaagacaagaagaaaccaatgcctcat
attaaccgtgaaaataaaccatcaatagtcactaaagctgaaatcacaaagctaccagca
tctaagatccgaagtcttaatcctgtgtttggcggggccggtccagctctaactggactc
aggaaccttggaaatacttgttatatgaattctatcttacagtgtctctgcaacacgcca
catttaattgaatacttcaataataatttttatcaagcacacatcaacagatcaaatctg
ttggggcataagggtgaagtggctgaggaatttggctgcattatgagagctttatggact
ggtcagtacaaatatatcagtccaaaggactttaagataacaattggaaaaattaatgag
cagtttgctggatacacccatcaagattcccaggagttgctgctgtttttaatggatggg
ttgcatgaagaccttaataagaaagcagacaatagaaaacgtcaaaaagaagaaaacaac
gaccatttaagtgactcccaagctgcagactctgcatggtacaaacacaagcaactcaat
gaatcgatcattgttgcacttttccaaggccaatttaaatcaactgtgcagtgtctaacg
tgccagaaaaaatcccgaacatttgaggcgttcatgtatttatctctgccacttccatct
acaagcaaatgttctcttcaggattgcattaaagcatttgccaaggaagagaaactcaca
gatagtaatagatttgattgcagtaattgtaaaactcagagagttgctacaaaaaaaata
gagatttggaagcttcctcctattcttctggtgcacttaaaacgcttttcatttgaggga
aggtggaggcagaaactccagtcatatgtcgactttcccctggaatccttagacctttca
caatacgtcattggtccaaagaatgtaaaaacatacaatttatttggagtatcgaatcac
tatggaggtttggacggcggacactacacagcttattgcaagaatgcgctgaaacagcgg
tggtttaaatttgatgaccatgacgtttctgaaatctccgtatcatctgtgaagacttcc
gcagcctatatgcttttttacacttctttggatgcccgaggtcttgagatttcagcgtaa

DBGET integrated database retrieval system