KEGG   Xenopus tropicalis (western clawed frog): 100124313Help
Entry
100124313         CDS       T01011                                 

Gene name
usp37
Definition
ubiquitin specific peptidase 37
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100124313 (usp37)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100124313 (usp37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 976 aa AA seqDB search
MALHSLHGPIRIHCLKVGTSKWKEGCCEVIEKDNKYCLVVNYNAGGMPTRFQLNQNIKTI
VVKPNGGTQSRFMLTLKDASSLTIDKVPLKDAENLKHFLESLDKATIVKSNQGSGSFSGV
LGNRSTQIEANRPLLNKTQTPSKRVSFDGKDETPVKKLLSNTGRAPVKSSPGNTVSSGRS
GINVTPSPPQRTSMMESRSEKRKRIQTPSPEIVEDYPKENDSSTTNKALSDTGRRFLNSS
REKQLSLKQTEENRQGLMPLQSSSFYSSRLTPKEFTTSNTYPDRSSASSQPPPAKRSLVL
PSQPSPLSVKKLKPNQDYPGWNKQRVLSTHPQPQQLQGFSNLGNTCYMNAILQSLFSLQP
FAHDLLKQGIPYRKIPTNALIRRFAHLLAKKDICSPEVKKDLLKKVKSAISATAERFSGY
MQNDAHEFLSQCLDQLKEDMGKLNKTWKTELSSGDDVPGVKANDDLSTRIYTCPVTCNFE
FEVQHSIICKICGETVNKREQFNDLSIDLPRRKKPSPSRSIQDSLDLFFRLEDLEYACEK
CSGKSATVMHKFSRLPRILILHLKRYSFNVILSLNNKVGQQVVIPRYLTLSSHCTESTRT
PLSLGWNAQTALNARPLKLSQMVNSCTMSTSTPLRKQMFKAANSLPVCLDSESDDEQIKR
CVSHSQRICDMELKEQQCEDKDKKEASKCLETGDACFDEMNDDELVAAVLEMSKKETSLS
ESHDDEDKLSSSPDTGFGGDDDVQEIAENHEPMEEERVKTAKEMGVLQYSDMAKDFDENK
ENKTPEASQNDVDWLQYDLEREREEQELQQALAQSLQEQEAREMKEDDDLKRATELSLQE
FNNTLMDGMVSDEDSGNEEVLDMEYSEAETEELKKNAETGDLPHSYRLISVVSHIGSSSS
SGHYISDVYDVRKQAWFTYNDLEVSRTQETTVQSDRDRSGYIFFYMHKDVFDELVEEAKK
SQPASTELNRPIRPPL
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcatagcctgcacgggccgatccgaatccactgtctcaaagtcggaacatca
aaatggaaggagggctgttgtgaagttatcgagaaggataacaaatattgcttggttgtg
aattataatgcaggtggcatgccaacaaggtttcagctaaatcagaatatcaaaactatt
gttgtgaaacccaatgggggtacacagagccggtttatgctgacactgaaggatgcaagt
tcccttaccatagataaggttcctctgaaagacgcagagaatttaaaacactttttggaa
agtcttgataaagcaactatcgtaaaatctaatcaaggatcagggagctttagtggcgtt
ttgggaaacagaagcacccaaatagaagcaaacagaccactgcttaacaagacacagact
ccatcaaagagggtcagctttgacggtaaggatgagactcctgttaagaagctattgagc
aacactgggagagcgcctgtaaaatcatccccagggaacactgtgtcttcaggtagaagt
ggtataaacgttaccccatctccaccacaaaggaccagcatgatggaaagcaggagtgaa
aaaagaaaacgaatacagactccaagcccagaaatagtggaagattaccccaaagagaat
gattcatcgaccacaaacaaagcgttgtcggatactggacgcagatttttaaatagcagc
cgtgagaaacagttaagcctaaaacagacagaggaaaacagacaaggattaatgccattg
cagtcatcatctttttatagtagcagactgactccaaaagaatttaccacatcaaataca
tacccagacaggtcatctgcatccagtcagcccccacctgccaaaagaagcttggtccta
ccgtcacagcccagccctctgtctgtcaaaaaactgaaacccaatcaagactaccccggc
tggaacaaacaaagggtactttcaactcatcctcagccacagcagttgcaaggtttttcc
aatctgggaaatacctgctatatgaatgccattttgcagtccctcttttccctgcaaccg
tttgcccatgatttgctgaagcagggaattccctataggaaaattccaacaaatgcatta
atcagacgctttgctcatctactagcaaaaaaagacatctgcagccctgaggtaaagaaa
gatcttctgaagaaagtaaagagtgccatatctgcaacagcagagaggttctccgggtat
atgcagaatgatgcccatgaatttctgagccagtgccttgatcagttgaaggaggacatg
gggaagctgaacaaaacatggaagaccgaactgtcctctggagatgatgttcctggtgta
aaagcaaacgatgatctgtccactcgtatatatacctgtcctgttacctgcaattttgaa
tttgaagtgcagcattcaatcatctgtaaaatttgcggtgaaactgttaacaagcgggaa
caatttaatgatctctcaattgaccttccgagaagaaagaaaccatcgccttcccggtca
atccaagattctttagacctctttttcaggttagaagaccttgaatacgcgtgtgagaaa
tgtagtgggaagtcagcaacagtaatgcacaaatttagcaggctaccaaggattcttata
ctgcacctgaaacgatacagtttcaatgtgattctatctcttaataacaaagtgggtcag
caagttgtcatccctcgctatcttaccttgtcgtcgcactgtacagaaagcacacggacc
cccttgtcccttggctggaatgcacaaactgcattgaatgcacggccgttaaaattgtca
cagatggtaaattcttgcacaatgagcacttcaacacctcttagaaagcagatgtttaaa
gctgcaaacagtttgcctgtatgtctggattccgaaagtgacgacgagcaaatcaagcga
tgcgtctcacatagtcaaaggatttgtgacatggagttgaaagaacagcagtgtgaagac
aaagataagaaggaggccagtaaatgcttagagacaggagatgcatgctttgatgaaatg
aatgacgacgagttagtggcagcggtgttggaaatgagcaagaaggaaacgtccttgtct
gaaagccacgatgatgaagataagctctccagtagcccagacacaggcttcggaggagat
gacgatgtacaggaaattgctgaaaaccatgagcctatggaagaggaaagagtaaaaact
gcaaaagaaatgggtgtgcttcagtatagtgacatggcaaaggattttgatgagaataaa
gaaaacaagaccccagaagcttcccagaatgatgtggactggcttcagtacgacctggag
agggagcgtgaggagcaagagttgcaacaggcactggcacagtcacttcaggagcaggaa
gctcgagaaatgaaggaagatgatgacctcaagagggctacagagctgagcttgcaagag
ttcaacaataccttaatggatggaatggtttctgatgaagattctgggaatgaagaggtt
cttgatatggaatattcagaggcagagactgaggagttaaagaaaaatgcggagacagga
gaccttccacattcatatagactcatcagtgtggtcagccatattggaagctcctcttct
tcaggtcattatatcagcgatgtgtacgatgtccgaaagcaagcttggtttacctacaac
gacctagaagtatctaggacccaagagaccactgtgcagagtgaccgagacagaagtggc
tacattttcttttacatgcacaaagatgtatttgatgaacttgtagaagaagcaaagaaa
tcccagcctgcctccaccgaacttaaccggccgatcagaccacctctgtga

DBGET integrated database retrieval system