KEGG   Xenopus tropicalis (western clawed frog): 100124713Help
Entry
100124713         CDS       T01011                                 

Gene name
ehmt1
Definition
euchromatic histone-lysine N-methyltransferase 1 (EC:2.1.1.43)
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100124713 (ehmt1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100124713 (ehmt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 1236 aa AA seqDB search
MAGDENLSDKQVGETNGSCEKNESKELGLLTLATPDSTKLPHQDCVFKTFRVAENGVYDR
DTEGQYPLKASNPTQTSVTGSNGYILNKPAILEQPLRTSSLSPLSGHAAKTLPVAASKPK
AASNVYVPPAPSPVPPNPGDPGRVENTKQQDSALPDLKVHRARKTLPKTSGSSPIHKEPK
EPSEQDETKDESAPKNGLDDEKEEPQSPSSAPQQLLPQGQNSAKSLSAALVCRKKKRRMG
MYSLVPKKKTKVPKQRSVLEMFRNITYTSSSPKSEKESDVPHVNGESMEMDSEDEDSEDM
EEEDYHSSETPASESQEEPGVPKEATSEADSSRKVDEVDSEGDEDVESGDSVEEEDDGAE
SDLSSESSLRKKQEKKKTLAESPWMKGSRRRKRKNKENPNPLLASSGEAREASMEYTEVS
LDSLDLRVKEMLSPQSNDLSNGSEAMELDGLQGIPLCSCRMETPKEEEVSAKAGEHCMAI
ESTGQELGRCTNRVAKYELMRPSNKVRHLVLCEDHRGKMVKHQCCPGCGYFCTAGTFMEC
QPDSTISHRFHKDCATRVNNSSYCPHCGEEASKAKEVTIAKADTTSSLAPVTGEWEKVSA
AEGQADTTTESEAMALKAPEENKQEATSSLPGGTPEPIETPSLGKPPSLSQGPVKETLES
ALLALDSEKPKKLRFHPKQLYFSARQGELQKVLMMLVDGIDPNYKMEQHSRRTPLHAAAE
MGYTDICHMLIQAGANLDSCSEDQRTPLMEAAENNHLDTVKYLVKGGALIDPKDSEGSTC
LHLAAKKGHYEVVKYLLSSERTDVNCQDDGGWTPMIWATEYKHVEIVKLLHSSRADVNIR
DNEENICLHWAAFAGSVEIAEILLASKCDLRAVNIHGDSPLHIAARENRHECVMLFLGHG
SEVGLKNKEGETPLECSAPNSDVWAALSKCQALPEKPTLQEKVVDRDISRGYENIPIPCV
NAEDSELCPVNYKYVSQNCVTSPLNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDK
NGRLLPEFNMLEPPLIFECNHACSCWRNCRNRVVQNGLKIRLQLFRTKSKGWGVRSLQDI
PQGTFVCEYVGELISDAEADVREDDTYLFDLDNKDREVYCIDARFYGNISRFINHLCEPN
LLPVRVFMSHQDLRFPRIGFFSSRHIGAGEEIGFDYGDRFWDVKGKLFSCQCGSPKCKHP
IKVLSPSQSFAPAETPSEIGLPDTSSATPPSPSQPQ
NT seq 3711 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgacgaaaacttgtcggacaagcaggtcggtgaaacgaatggatcttgtgaa
aagaacgagtccaaggagctcggtttattgacgcttgccaccccagacagcacaaaactc
cctcaccaggactgtgtttttaaaacttttcgtgtggcagagaacggggtgtacgaccga
gacacggaggggcagtaccccttaaaagcgagcaaccccacacagacatccgtaacggga
agtaatgggtacattttaaacaaacctgccattttggagcagccattaaggacttcaagc
ttgtcacctctgagtggccatgctgctaaaactctaccggttgctgccagcaaacccaaa
gcagcttctaatgtctacgtccctcctgccccttctcctgtccctccgaaccctggggat
ccggggcgggttgagaacacaaagcaacaggacagcgctttacctgatctgaaagttcac
cgtgcaaggaaaactctaccgaagacaagcggcagttcgcccatccataaagagcccaaa
gaaccatccgagcaggacgaaaccaaggacgagagtgcacccaaaaatggtttagacgac
gagaaagaggaaccccagtctccctcctctgcccctcaacagctgctacctcagggtcaa
aactctgccaagtcgctctcagctgcactggtgtgtcggaagaagaaacggcggatgggc
atgtacagcctcgtacccaagaagaagaccaaagtgccaaagcaaagaagcgtgctggag
atgttccggaacatcacctacacctcttccagtcccaagagcgagaaagagtccgatgtt
cctcatgttaacggggaaagcatggagatggattccgaagacgaggattcggaagacatg
gaagaagaggactaccacagttcggagacgccagcctcggagagtcaggaagagcccggt
gttcctaaagaggccacctcagaagccgacagttccagaaaggtcgatgaggttgattct
gaaggagatgaagacgtggagtctggggattctgtagaggaggaagatgacggagcagag
tctgatttaagctcagagtccagtttaaggaagaagcaagagaagaagaagaccctggcc
gaaagcccctggatgaagggttctaggcgacggaagagaaagaacaaggaaaatcccaat
ccgcttctagcttcatcgggagaggctcgggaagccagcatggaatacacagaggtctca
ttagactccttggatctgcgcgtcaaagagatgttatctccgcagtctaacgatctctct
aatggctcggaggccatggaactggacggccttcaggggatccccctctgcagctgccgg
atggagacccccaaagaagaggaggtgtcggcaaaggccggagagcattgcatggccatt
gagagcactggccaagagctgggtcgctgtaccaacagggtggcaaagtacgagctaatg
aggccttctaacaaggtgcgtcatctggtgctgtgtgaggatcaccggggcaagatggtc
aaacaccagtgttgtcctggctgcggttacttctgcacagcggggaccttcatggaatgc
cagccggacagcaccatctcccaccgattccacaaggactgcgccacccgggtcaacaac
tcgagctactgcccacactgcggggaggaggcctccaaagcgaaggaggtgaccatcgcc
aaggccgacaccacgtcctccctggccccagtgaccggcgaatgggagaaagtcagtgcg
gcagagggacaggcggacactacaaccgagagcgaggccatggctctaaaggcgccagag
gagaataagcaagaagcaacatcttccctccctggaggaacccctgagcctatagagacc
ccaagtttgggcaaaccaccctctctgtctcaggggcccgtcaaggagaccttggaaagc
gctctactcgctttggactctgaaaaacccaagaaattgcggtttcacccaaagcagctg
tatttttctgcccggcaaggagagctgcagaaagtcctgatgatgctggtggacggtatt
gaccccaactacaaaatggagcagcacagtcggagaacaccacttcacgcagcggcagag
atgggttacacggacatctgccacatgcttatacaggccggagccaacctagacagctgc
tcggaggatcaacgcacccccctgatggaggcagctgaaaataatcatctcgatactgtg
aaatacctggtgaagggcggagctctaattgaccctaaggactccgagggctccacttgt
cttcatctggcggccaagaagggtcactacgaagtggtgaaatatctcctctcctccgag
agaaccgacgtcaactgccaggacgacgggggctggaccccgatgatctgggctaccgag
tacaagcacgtggagatagtcaaactgttacattcctcccgcgcggacgtcaatatccgc
gataatgaggagaacatctgcctgcactgggccgccttcgccggttccgtcgagatagcg
gaaatcctcctggcttccaaatgtgacctccgagctgtgaatatccacggggactccccg
ctccatattgccgcccgcgagaaccgccacgagtgcgtcatgctgttcctgggtcacggc
tcggaagtgggactgaagaacaaagagggcgagacgccgctggagtgctcggcgcccaac
tccgacgtttgggcggcccttagcaagtgccaggccttgcccgagaagcccacgctgcag
gaaaaggtggtggacagggatatatcccgggggtacgagaatatccccatcccttgcgtc
aacgccgaagactccgagctgtgtcccgtcaactacaaatacgtctctcagaactgcgtg
acctccccgctgaacatcgacagaaacattacccatctgcagtactgtgtgtgcatcgat
gactgttcctctagtaactgtatgtgtggccagctgagtatgaggtgctggtatgacaag
aacgggcgcttgttaccggagttcaacatgttggagcccccgctgatcttcgaatgcaac
cacgcctgctcctgctggcgcaactgccgcaaccgtgtggttcaaaatggcttgaagatt
agattgcaactgttccgcaccaaaagcaaaggctggggggtgcgatccctgcaagacatt
ccccaggggaccttcgtatgcgagtatgtgggggagctgatttcggacgcagaggctgac
gttcgagaggatgacacctacctctttgatcttgataacaaggaccgagaggtttactgc
atcgacgcccgtttctacggcaacatcagtcgctttatcaaccacctctgcgagccgaac
ctgctccccgtgcgagtctttatgtcccaccaggatctgcgctttccccgcatcggcttc
ttcagcagccggcacatcggcgcgggggaggagatcgggtttgattacggcgaccgattc
tgggacgtcaaggggaagctcttcagctgccagtgcggttcccccaagtgcaagcaccca
atcaaagtcctttccccgagccagtcattcgcccccgcagaaactccgtcggagattggc
ttacccgacaccagctcagccacccccccgagcccctcgcagccgcagtga

DBGET integrated database retrieval system