KEGG   Xenopus tropicalis (western clawed frog): 100124780Help
Entry
100124780         CDS       T01011                                 

Gene name
pla2g15, lypla3
Definition
phospholipase A2, group XV
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100124780 (pla2g15)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100124780 (pla2g15)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100124780 (pla2g15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 351 aa AA seqDB search
MCSKKTNYYFTLWLNLELLLPVVIDCWIDNIRLVYNKTSKTTAPPEGVDIRVPGFGQTYS
LEFLDPSKRSVGSYFYTLVQSLVDWGYTRDENVRGAPYDWRKAPNENSDYFVALRKLVES
MFESYQSPVVLVAHSMGNLYTLYFLNQQTQDWKDKYIHSFVALGAPWGGVSKTLHVLASG
DNNRIPVISSLRIRDQQRSAVSTNWLLPYNNTWPQEKVFVRTPNKNYTIKDYRVFYEDIG
FQDGWEMRQETEGLISSLNPPGVEVHCLYGTGVDTPDSFLYDSFPDKDPTTVYGGGDGTV
NLESALQCGKWRNQQRQKVSLVELPGNEHIAMLSNISTISYVKKVLFGLEI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtgctccaagaagacaaattattacttcactctgtggctgaatttggaactgctgctg
cctgtagttattgactgctggattgataacatcaggttggtttacaataaaacaagcaaa
actactgctcctccagagggagttgatatcagagttcctggttttgggcagacttattcc
ctggaattcttggatccaagtaaaaggagtgtgggttcatatttttacacgcttgtgcag
agcttggtagattgggggtatacccgcgatgaaaatgtgagaggtgcaccctacgactgg
cgcaaagctcctaatgaaaattcagactattttgtggctcttcgcaagctagtggagtct
atgtttgagtcatatcaaagtcctgtggtgcttgttgctcacagcatgggaaatttgtac
accctttactttctcaatcagcaaacacaggactggaaggataaatatatacattccttt
gttgctctgggcgcaccatggggtggtgtgtctaagactctgcatgtcctggcttcagga
gataataatcgcattccagtgattagctccctgaggattcgtgaccagcagcggtctgct
gtttccaccaattggctgctcccttataacaacacatggccacaggaaaaggtttttgta
agaacacccaataaaaactacacaataaaggactatagagtgttttacgaggacattgga
ttccaagatggatgggaaatgaggcaagaaacagaaggactaatatcctcactgaatcct
ccaggagtggaagtacactgtctttatggaactggagtggacacccctgattcgttctta
tatgattctttcccagataaagaccccactacagtttatgggggaggggatggaacagtt
aatttggaaagtgctttacaatgtggaaagtggaggaaccagcaaagacagaaggtgtcg
ttggttgaactacctggtaatgaacacattgccatgctgtcaaacatttcaaccatctct
tatgtaaagaaggttttgtttggactggagatctaa

DBGET integrated database retrieval system